SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|189553 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|189553
Domain Number 1 Region: 363-586
Classification Level Classification E-value
Superfamily Kelch motif 2.88e-44
Family Kelch motif 0.00032
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|189553
Domain Number - Region: 88-147,186-216
Classification Level Classification E-value
Superfamily POZ domain 0.00298
Family BTB/POZ domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|189553
Sequence length 689
Sequence
MSDIIDPVLRNFEARVEKIILIELLSNKNLVEVEEMQEEGFEMNKNCKMETAEKNDFVDE
ERSVKMDKNGKMENDDAVDEPAKMVLISNEGGRNEVAKDLLLQSSDYFQALANSGMRDAN
FKELTLECLSDACLHEVEHFLSNVQSNEDHFGARDLCYVEKGLEGSLYLQIQSMTDKYLN
NLFELLNESTYARILQFANKFAVFGAIERVFEFIFDNFKCIISRSEILSLSPDGMIRLVE
SELVNAVRELDIFDLIIRWTAADESREQYAKQLFRKVRYNLMAVHEKMKAKKVLKKLEIN
IRSKGHGFRTVGTILGFGYSRFKIGSPKIGCSLSIYDFLKTITNKANQSPVVVFKPTKIW
RQSSHFRNYSSHRVCAANNRIYFAGGYYRYNLPKDLVKVYNTITRKWSRLSNMLVARGFF
YFGEMGGHLYAVAGEGVTGENTRTVERYAPDKDKWKIIAPLPIAVLAPSGTARNGMLYVS
GGMISYRNPANKMYMYKPALKQWFEKAPMLAGRYDHAMAALGDKIFVFGGNCLRIVNGLE
SFELSAHDGEMFDCKAEQWTQILRNKVPSYSVRHHMLINDSLFCFFHDLGKPHYSILEIK
LKKATILMQQDFINTDVPGFSEESRLKCVSLFSMKAMPYSRLKHGYPWAEIILKTCLLSG
VQLSLLHTYMNTLFVDQVLRLPRGTVMIV
Download sequence
Identical sequences T1FR52
XP_009028961.1.102002 jgi|Helro1|189553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]