SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|189564 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|189564
Domain Number 1 Region: 304-524
Classification Level Classification E-value
Superfamily Kelch motif 7.98e-46
Family Kelch motif 0.00023
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|189564
Domain Number - Region: 26-119
Classification Level Classification E-value
Superfamily POZ domain 0.0706
Family BTB/POZ domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|189564
Sequence length 653
Sequence
MDKRIKMEIKKADDVDGSKMVVLISKTGGRFEVDEDILLRASGYFEGLVNSGMRDARFKE
LTLELMSDESLIEICEFLSKLLNDNRNNGYQCTKSKSYKMLKEGLKGASYLQICSMIHVY
NDLLSKYLSTFPRILKFASKYMLPDVLNNVREYVTENFRKLGMTSSVLKLAPDDICYLLE
SDFFNAESEFDIFNFVIRWISADESRRQHAEKLLTGVRYGLMTTGEWQRSNEILDELELN
INKKEKVVENFRSVGTIFALGSSPFKDVQPQVLSVYDFIKTFEEERKDARSDSVQFRTAN
RLGPLVPCCRYKVCMVDKCLYLAGGGIVPQRLTDEIHVFDLTDSTWTQCSKMNVPRKNFY
FGEMNGHLYAVSGRSFISLTGTVEKYVPREDRWLMSAPLPVETFNLAGCVCNGRMYVSGG
LNAHGTSKQVWRYIPDGSEWTEMAPLLNERMDHVMTTLGNRLIVIGGRKCDFDSENVMSG
EVYDSEADQWTRLLTLKKPAINSAFLNINDCLYLFGTENFESDNYFFVSSSVETFVQKIN
LSRWVLRFALNFASDGEVVREYFYICGQHLYIRGQYLYICGQYLYICGQYLYIRGQYLYI
CGQYLYICGQYFYICGQYLYICGQYLYIRGQYLYICGQYLYICAQHLYICDQF
Download sequence
Identical sequences T1FR57
jgi|Helro1|189564 XP_009028983.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]