SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|189581 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|189581
Domain Number 1 Region: 292-524
Classification Level Classification E-value
Superfamily Kelch motif 1.05e-44
Family Kelch motif 0.00019
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|189581
Domain Number - Region: 28-89,128-158
Classification Level Classification E-value
Superfamily POZ domain 0.000115
Family BTB/POZ domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|189581
Sequence length 592
Sequence
MKKKGVELNKNCKMEKDNAVDEPAKMVLISNEGGRYEVAKDLLLQSSDYFQALANSGMRD
ANFKELTLECLSDACLHEVEHFLSNVQSNEDHFGARDLCCVEKGLEGSLYLQIRSMTDKY
LNNLLGLLNESTYARILQFANKFDLFEAIERVFEFIFDNLKCIILRSEILSLSPDGMIRL
VESELVNVDCELDIFDLIVRWTSADESRRQYAELLFSKVKYNLMAEPEKRKASNVLEKLK
INVQTEDHGFRTVGKIFGFGAPEIEVEQPFSSLSVYDFVKTLSNKTTVFPFDDFKYIKIR
KWIPLFVGHRICTANNQIYFAGGVYKCDSTTKSLKVYDVISSKWSQLSSMHVARAFFYFG
EMGGHLYAVAGVTLFGDHRTFIQTAERYIPGEDRWYTIAPLPIAVAFLSGTACNGLLYVS
GGYKEDGISVNLVYMYNPACNQWFEKAPMLTARNDHFMTALRDKIFVVGGKRVPTVEVED
NLESVMDAEMFDCTTEQWTSVLTLKQSFWTPQNAIILNGSLFCFTLNWFKHNYSIQEINL
KKYLDVDTSSSNATSDEDACILYNYSTQSDLIWAWDLQAFYITIPTIPLNQI
Download sequence
Identical sequences T1FR62
jgi|Helro1|189581 XP_009029016.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]