SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|189589 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|189589
Domain Number 1 Region: 861-1023
Classification Level Classification E-value
Superfamily vWA-like 5.4e-20
Family Integrin A (or I) domain 0.0076
Further Details:      
 
Domain Number 2 Region: 679-739
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000948
Family BSTI 0.047
Further Details:      
 
Domain Number 3 Region: 1992-2031
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000952
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 792-826
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000978
Family EGF-type module 0.027
Further Details:      
 
Domain Number 5 Region: 2394-2453
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000141
Family ATI-like 0.035
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|189589
Domain Number - Region: 240-294
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000147
Family ATI-like 0.038
Further Details:      
 
Domain Number - Region: 348-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000177
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 1882-1942
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000294
Family ATI-like 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|189589
Sequence length 2520
Sequence
MPVNNFIFLLLHLMQQFNGSPLSVPFRSPTGEYSVAYEGSSVRYTSAFGFTVWFLTNYRV
NVEVTSDLRSQLTGLCGNFDGNARNDLQVNGLDVSSLPDPGNAVGNSFIVQENQTSSTTF
FESWFSTSPSAPTTSPLSPTTTMLSPDIQTPDTCPAGNAKFRLSCSQFGDLSGLFSTCLK
LMDAVEVSAFVESCQFDVDYTCEGADVVKQAYLTLTLDCYSRFGVTIQHDVEPDCNCVEP
NTVCMATAPGCPATCDNPTHPSTCIQPDAKYVCACQPGFLLFNGRCVPPTDCGCVYTDGR
FFKKGDSWISQDCKLKLTCSAPNIYTSGVFSCPAGRACVSGACLACTNSQLCGTNGDCIE
TSTTKGYVCKCKPGFMGDTCNFSLSKATYSRTHCTTFDKATFDFKGIGNFLFAKSTLKAV
PGLPKLINFMEFEVRAVNVYLVNTKEIAYAKILIINFLSHHIVIDRDLEGLDARITVTVD
GNIVNLPYNSTDFEIVWNSLSSVDFSSNLGSFVVTYGASDSTITVTIPSSYFSGGKGLAP
PNGLTGVCGGFDGIPDNDLVTADNRSVASSPDPGFEIGLSYTDKSDPYFKNLTSLPNEVL
SKECSNATLLNKCNLIQSALFRPLLVTLGVSEAQTFVKNCIADVTRLCNLDAFCTAAERV
AKLAEALGFVTEWRNILGCPLQCPPGQIFSPRSTGCPETCDDPDAPATCTEPDLIGECVC
PPGQVLFKDKCVNRTSCGCADVATGRFYEIGQSWRSLGCAKKMTCTEGGNVTQVTAGNCS
KGFCVGNRCSGCTPNPCLYGGQCIETSEEGDFICKCPPGVFGKRCGGSNSQADIVIMIED
GPADCNPAENNFNSCVFGFYRKILNFLSSFVANLPLGGGDIRIAGVSFSSQPQLLWSFDD
YTKVADLQTAINQVTLGNANQPINLAISIDFIISQVFQISNIISTTIRTPTLTLTPPAPK
ILLIFTDAQPKADASKIGMVVSKLATSGVQVYTFGLTSRVDVNLLGQISSSPKQKYANFF
PSFMDISVDVLKQILKIVDLNVPSPFNGKNPFDPNGPLPKFPQLTAKCKCTGDTHCKTFD
GLNLDYQGTCKTLLSSNNLPGNTSLNGPNITAPPFSVYIHNYHREPNSKVAWVRNVEVVL
GAKVIRFIKIGESYSAIASVTVDGVSVEPPHVNNDFTIIYNADGLELRTTDGSLVVGYNV
NGMASVDIPNYLTKKVYGICGNFDGNQGNDLVTKDGQDVSGMRDPGKFVGDSYIVMGDVD
NAGIMDSCKPPAVTNQTCSPSMKELTMKCNLLTDVNELFGECINKVGRKVAQIFQYDCLF
DLQQTCDESVVEPAIFQFVLYCFQYAQVDIPDWRRKLKFPCRCSDDKICIPKGPPCQPNF
FFPDKSSVCALPDAIDVCTCPPRKVLFNGVCVDLQQAGCIDAEGRARKTGEIWLSKDCTQ
LLTCAGLNNIKSEATSCPDQTSCFNGKCSACVAAQPCLNGGSCLETLTCQDKSPTNPGCY
WKKFANKKSLASTSSGLSAVSQLADCFQACYQTSRTDCMGINWNPSANMGQRCGLVVKAG
GDLVDDVSFTYYEWTCSTSGTCMLSEGPQISTFDGFSLLYRAPCMIILTSFNVPTLPTFS
VASKNVPAWKQGAAAATTWTREIMIQWNGRLIKFKSDGLGIPKCDVFDMLTNVKLPYTAP
FSVDDISVQVVGADLEFSTSSQIKVGLAKSGRSYIIMPPTYSGKVMGTCGNFDGVKENDG
IPFSGSLAGSAQSGFTGIGGGGNSTDVGNSVGNSYYVSDFQYPYLSNCSVPDLSNTSLTP
VPPIPLDKSRCDAIVSANSSFAACVALLDPAMVAIFVNTCKFNVDFFLNDLLSCTALESF
VDLCKLSVGVSTPSGWRETFKCKCQCAPGFVCAPSSPACPATCNNPDAPKTCLEPELQDV
CVCPAGKLLLNGTCVLPSMCGCVDGFGTARKTLEKWLNLDCSMEYTCARNGTTSSVPFTC
PAGTLCTAGVCSACASNNPCQNNGTCIDVMNSPNPICKCLTGFAGKFCEYSGSNNTCTIS
GNGHLLTFDGASLDFGGDCKFLLLQSLPPAPLFKVFGKNFVINKNAAFLRYVEIETAIGV
LRLERPELSLSTMGSVDVSMNGSLIHLPLKGDQWEVAYRGQKVEWRTDFGVSILYHNWQA
IIKLPSQFAGSLIGLCGNFDGSKDNDMMQLNRRPPVSTTKPGQEIANSFIVNDLEAIDPN
SCMDLVNNPVPVDDPVAPPVPAPSGVVVPAVTGTLPTVTATVGPSSSVTAVASVTGSPLS
FTATRPVGGLTTAPNLTQPPTPPAGCQLSAFEINKYTLLCTQVIDVHAAFAACANVLGSN
LFIQAQTKCQLDVVLTCSADMFTLAFSSLVVLCQEVGVVVTVNSTANFTLPSPSCPVNGM
VLNPAPSSPCLATCADLDAPKHCTFPDEVNVCSCPPGFVFSSKRCIPRNQCGCVSKTGMS
YNVGSVWFETGCTKKYTCLGPSEIKEEENKSGTCILFTPHSHPPSSFFEFFRQIYLNFKV
Download sequence
Identical sequences T1FR64
XP_009029026.1.102002 jgi|Helro1|189589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]