SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|189594 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|189594
Domain Number 1 Region: 326-550
Classification Level Classification E-value
Superfamily Kelch motif 3.92e-45
Family Kelch motif 0.00017
Further Details:      
 
Domain Number 2 Region: 47-109,148-178
Classification Level Classification E-value
Superfamily POZ domain 0.0000133
Family BTB/POZ domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|189594
Sequence length 626
Sequence
MDGEMSKKRKIESVETDGAADDGESVEMNKKLKMEKEDDVDESSKIVLISNEGGRFEVDK
DLLLQTSDYFRALANSGMRDAHSKELTLECLSDASLHEVNNFLSNIQLNEDFFYARDLCC
VEKGLEGSFYLQIRSMTDKYLFLFSQHLNESTYANILQFANKFALFGAIERVFEFIFDNL
KCIISRSEILSLSPEDMIRLVESELVNVEREFDVFDMILRWTLVDELRKQYAEPLFSKIK
YNLMAVDKKKKANDILNDLQINLQTEIHGFRTIGTIVAFGKPDFKDNIQQPYFSSLPVYD
FFKTVNKEATESPVVHFKTTNIQLQNFRKWGYSVCTFDNGIYFAGGYCPLTKEVSVYNPT
FCKWSRLSDMQVARHGFYFGEMGGHLYAVAGETFKGVITRKVERYIPDEDRWYIMAPLPI
AVIMLSGTACNGMLYVSGGWKVPDTLVNLVYMYNPALNQWSEKAPMLTARHDHVMTSVGN
KIFVVGGRFYKNVDGVIVSEYVMDGEMFDCTTDQWTSVLRIKEPFNKPRTSVLINCTLYC
FGFDYGNEGSQNLLSIQEINLKRFLNDNKSSPNALSDLAPNDELEKKISNRTDDEYIDSE
DSCHIHKFFTSHDRSIYYVGLIDKLL
Download sequence
Identical sequences T1FR66
XP_009029036.1.102002 jgi|Helro1|189594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]