SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|189692 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|189692
Domain Number 1 Region: 181-267
Classification Level Classification E-value
Superfamily Immunoglobulin 7.53e-17
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 271-335
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000471
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|189692
Domain Number - Region: 76-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00829
Family I set domains 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|189692
Sequence length 356
Sequence
MDKTCRNKDINGDNCCSNEDSHSTFNICDQMTLSLMTPSRQTLLYNTPAVFICKAHVLPL
YLNGSGEGELTVPPHITVNVQWFLNNNEHLVNNKEGTIKIWQREEKLNLKMSVLRLAGAY
VRRAGNVECRASVDQWIKYAGSAWTRSKGVITTRSLTKLTVLRNITEVRGFPKLHMEPVA
GDLLALSGRHVLLKCEGYARPSPSVLWLKNGMEPIDNLTDSRYVLFNPGLLRIENLRRED
AGLFECRANNTFGTNVGQINLIVTEEPCDLIHCKFGAKCVFQRGEAICDCMHKCLHEKQN
LLCSEEGVTYQNYCEVQFEQCQKQKLITIIHRGKCDLRTRKHGSGSSYISFFMPNT
Download sequence
Identical sequences T1FR94
jgi|Helro1|189692 XP_009030201.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]