SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|189840 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|189840
Domain Number 1 Region: 308-541
Classification Level Classification E-value
Superfamily Kelch motif 1.7e-43
Family Kelch motif 0.00017
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|189840
Domain Number - Region: 24-117
Classification Level Classification E-value
Superfamily POZ domain 0.0102
Family BTB/POZ domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|189840
Sequence length 813
Sequence
MMKDVDDVESNDGSTGERIVLISKSGGRHQIDKNILHWFSDYFKGLVNSGMRDAHCRELT
LDCLTNESLIEVKDYLSEYSTEVMESGGTCLKSLNEVEAGLEGAFYLLINNMIDSYIELL
LKHLNESTCIRILDIANKYVLINQLEEKVIKCMSKNFKNISESSKTLLSPDEMFCLVASE
EINANSEMDIFNMIIKWILKNQSRKCFAEKLLAEVRYSLMTTTEKQKCSAVLCDLNLHIN
HSKDKDSNISRTVGMLFATGSPKNVNLIGDVVHFIPVYDFVEACKTSSNCNVEPIPIKFK
PPRRVGQPLKRLYYKASMVDNCLYLIEEGRGLTMTSKVSAYNLVTDVWFKCCSMHLERCN
FYLGGLDGHLYVVSGYTPGVYETPTVEKYIPSENRWYMVEPLFLALPSLAGCVCNGMIYV
SGGRDKGANVRNVVYRYDPSYNKWFSRAPMLTARCAHLMTSTENKIFAFGGSKEPSVDFI
LSDVMDGEMYDVESDQWSSVLKLKMPVSYLPSITINNCFYIFYECMARWDYPFIQKINLA
KYLKNKKTSYDSSLSSVQCGNANNKNLVTNEAKEQNDAESDDDCQILNYFLPNYGNRTLE
CQYVGVMSVSDLDGSNKKTMLECVNSFYIVKDAGTKINPRCPPVMALHCKLFFFHIKIKS
LGLVTEWLACPSTTSTTRVRILQFLQSQNHKLDRNLSKKPQAGDLSHKPVYNKTIYDLPL
AMKNQNQQPMCDEGAENIKKDFSAFVDAEELEERKQKIVMKENATEDDIAAFKIQKVKYD
TIVDTKLKREAAYALVCAIETRKPKSAGLMHCS
Download sequence
Identical sequences T1FRE8
XP_009031287.1.102002 jgi|Helro1|189840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]