SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|189921 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|189921
Domain Number 1 Region: 302-513
Classification Level Classification E-value
Superfamily Kelch motif 2.88e-42
Family Kelch motif 0.00014
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|189921
Domain Number - Region: 22-122
Classification Level Classification E-value
Superfamily POZ domain 0.00345
Family BTB/POZ domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|189921
Sequence length 602
Sequence
MNMDVDDVEGNDVSTVERMVLISKSGGRHPVDRNMLLRTSEYFQGLVNSGMRDARYRELT
FECLTNESLIEVRDYLIYLSINMMGNKGLSIKSLNEVEAGLDGAFYLQMNDMIDRYIEML
LKHLNESTCIRILDIANKYLLIDQVVKKVIEYILKNFKKISDSSKISLSPDEMFRLVASE
EINADSEMDIFNLIIRWVSEDPSKKYFAEKLLTEVRYSLMTTSGRQKCTAILHDLNLNIC
YNKDKDSNISRTVGKIFAVGSTEKRDGTFLNILPVYDFVEACKTNGYGAWQKHVNFNPSS
RNGPQGDWIDYNACVLDNCLYLVGGKRSVTCKVFMYNPVTAVWSECRSMHFPRRHFYLGN
LAGHLYAVSGYTKYIKGTSTVEKYIPSENQWHMVEPLPLALPYLAGCVYNGMMYVSALHF
VYRYDSSSNKWLSRAPMLTARSHHCMTSTGDKIFAFGGTYKSIDRNYNALDGEIYDVESD
QWTYVFKLVHPVFDSPSITINNCLYIFQQESKFPNNVYRVIQKIFLTKYLKGKETPNDSS
LSPAQEAVKGNLPGNEDCQNVSLKFYKISFKLSQLQMRKYDLTILISKFYLTRPSRHDSI
LS
Download sequence
Identical sequences T1FRH8
jgi|Helro1|189921 XP_009031517.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]