SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|190013 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|190013
Domain Number 1 Region: 71-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000559
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|190013
Sequence length 330
Sequence
MAIIWKISFYSLLLLLLLLLMPSFYYHHPTITLACLSKPDSTPTTTMSPFLPATTTSRGE
TLCTEQEKNIQKCLNGATCKVSLTSNGGRTLYCQCLSGYEGVRCELQSSPLFRSSMAGAL
DAPVIVGIVAGVIVLLILTSTIIFLIVKKMRKDSRPQLDYALEPSHQEFPPLKKPAPSSN
YAISRGMTNYGSPYERSIVNQGFIPDDYIPTTKTTTAQPTKSNIYDNNNSNNHNNNNKNN
NNNNNDNKKSKPTKSTTTSASHKTSASPTQLFTISDGSGTRRSGVIITDDATDRASNASS
RPTSGAGSLHYTSGLTSLHVAPVAYKETTL
Download sequence
Identical sequences T1FRL4
XP_009010071.1.102002 jgi|Helro1|190013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]