SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|190218 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|190218
Domain Number 1 Region: 407-606
Classification Level Classification E-value
Superfamily ADP-ribosylation 6.33e-35
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0011
Further Details:      
 
Domain Number 2 Region: 936-1093
Classification Level Classification E-value
Superfamily vWA-like 1.13e-17
Family Integrin A (or I) domain 0.038
Further Details:      
 
Domain Number 3 Region: 3-94
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000209
Family DNA topoisomerase II binding protein 1, TopBP1 0.032
Further Details:      
 
Domain Number 4 Region: 298-400
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 0.0000837
Family Domain of poly(ADP-ribose) polymerase 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|190218
Sequence length 1999
Sequence
MGVFSGCTISLDFSNSTKVKEKNELRQLVTDAGGVLSFILNKQCKFLATNDAEKTKNSSK
CQMAIKLDIAVVSTAYLYECVSAGALLDVARYKIIPSASELSFERGIISDGKMTKPGSTL
SMLTASQSVNLKVWRATDARKPQFDEDDYHVVDYAVFLSSVKRVKQLKKILYEVLELHAS
EVPSSNKFYHFRIVSCTGQLNAENETLDSIDKLEYRYTDDSCTAMTTFSKLFDVISANSE
MKPTSNPGKYACSVKLEEACLLRSKAMCMTINRPEDGNLVEQVWQESVGSLDNLLDCPLS
TIKTKVDKVEAILVQIKQKLSGNSTKPSSSSSSSLLYANDNSKSLGQLLDEFYDLVPHKA
AHQKMDVDSKWLASKFDLCQLIRDMLNLSETTGFSDKCPTITKYRSLKCSINLLDESESE
YSDVINFINQSKLQQDGYPDISIKKIFSIHKPFEASLFQENTRKNFDKNDNTVRLFHCSR
PENVVGILSRGLLLPKVLDERIGGPLNEVRRLGGGIYFAESASVSSLYSMKSDHTSSRYM
FICEVNLGLEQEVTKECPELTSPPHGYHSVHALSSRKDPLSVFKDDEYVIYSTNQQMLKY
LVEFNWSTDGVKCNEDLYPCVPLVGSELNAGVHEVSLKLMDLASDDVAKMADPLTKVKAG
LLTSSGEESVPMKSVDVFVKMVDLVAEVVILQEYFEAKKAVKGVKTMPGEPTFTEVKYVL
PLDDMATVCGFEAFINDKHIIAEVKEKEKARKEYKEAVSKGHGAYLMDQDEQVPDLFTIS
IGNLPDDCNAVIKITYVTELSVDAHGNICFKLPGCVAPWKQDDMMGDLTQRATRTDWVHS
GDVTKTNLQVMVEMPSEIRSITSPTHVIRVKVETATKAVVETAPNVRLNRGFELVVALAQ
IHVPRMWVEQHPDQQDSRACMLTFYPEFESTSLDKYEIVFIVDQSQSMAHSKAFETARMV
LMMFLKRLPDNCLFNIILYGTDFSRLFVASKHVNESTLKEARGFLEKSTSLLGNTDLFPI
LKKYLILSSPSLTRNLLLISDGYLDSEAEVFRIVKQFPDTTRLFSVGVGTTANNYCLKNL
ARVGHGTYEYFDDLFKFKWQAKVNSHLEKFIQPALSDISIEWQNFNDVVDIVQAPAMFSA
LFNNSRLVVYGFAPDCTMAKLRAKVKGREISTIVSTSELSITTGHVIHRLAARSIIQDWS
CGTLSMNQLEDEVIKRLRMKYIINLSIQHSIITQYTSFIAVEERKENEQFHTIDKGKIVK
DCVVDQLPYMDWRPTICRVKLLTHDGQSTYADIKESSTLKDLISMIPTIITSSSTDNFVL
WTLTDAIFLNVADMEMNVWDLYGSLVDGVLCLPTSINITDEKSILSNADFRKEQVRLLLS
SIDTISRGVFEKIFDHIPMKLETLHKSTEACLEGGQHEAVGFAYVDDDFSFRNLSKNVEL
QDDEDMPLHESEEENETGFISPLIITNGPFQQTHAPPPLSYAPHPSLHAPPHLLFGQPPS
LAPLLPSQKALALQKVFHQVKLQKDSASEPSSLKLKFPPHPLATPAPPQPPPPPQQAAAL
TGRSMPTYSEMSAISSDQSTVAASFLESLPDSSSLRFRTAKNALVEETKLRRKQALPLKS
DLPLPPSPLPRNSLLTNLLESACAKEFELSPPVMLGRKKTTVESSCFVASKSLRLLEPEQ
LQLQQQQQQQQKQQLQQLIQRQTVHEYRPFEKKPKDDHRFRRPKSDDKRIFNEIFLRKAV
YNDYDYEDDGDGNSRADIVESCCSSKAPDLSRSSSSRSSSFKVCVADAAFKDGGWRSFYG
KRKKYKLKRNIAADIASEKDESSCDDSLSSMVDMFEEGQLENQLEEDDGDEEDRATINNV
KTFVKELDKLLALAIEDGQEVAYWEPNEEVESLLRCKVKVDIGDICKNFPGVYGADDFQR
INRFYVLHLAVCHAIRTMKRLQLNFSKLASYIWDYLPYKKAVLICKLVYYFMTIRKMYPK
IADGWSNDFGDEDMNKFSG
Download sequence
Identical sequences T1FRS2
jgi|Helro1|190218 XP_009011153.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]