SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|190317 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|190317
Domain Number - Region: 837-867
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00795
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|190317
Sequence length 1221
Sequence
MPCDASTFSRKKGDETFLTLSRDSPLNFIKRLYIATQVERRRDNIINSTLNALHDSKISP
GAWYRFWSPGGYEIIDKCPPLFSCGTQYPIWLDGKHPDIDGTDAISYYVCQRRQHDCCAS
RWVTHILNCSGYYVYKLHQTSSHGYSAYCAVIPSYKCKMKKYVMFRANLKIFTGTENPCP
PEMNSENGFTPGCTDNFPKLDGQVKLTMSQTDPSLTFFCDFRGRIDVRTVLVADWYVTSI
DDNNTYHLPVWTDHMVERKRSVLKEEWIKKKLGSNVYCEIRSKWKTSTSKVLSRPIRSET
LFAGIKLFNRIINVTESGGVGIIQLQSTIPVICLTNIDESNCKIIIEFAYNPQRGTYYYS
EDEDEIVSGDCSITLTPKNWKQVHNISVKAVRDFMNDGNKKIYLNFRKIFTTVATDMWNE
YQIPSVEIMVLDVHSALCSSYGDPHIQTFDKTVYDIFLEGEFLLYSNENLRTKVHIRTQR
CFNAACNCAVAVAVDDDVIVIDKCNRKNKKIVKGSNFPDGWNTLHRHSLEQGNRFVDGLR
VFEHDEGRRYTIHTPSGSFVDMHMVDEWININVFASSEDFNSSSGLCGIYDGNPRNDISL
NTNDYTEIDEILSCGSNEKLCQFVESWRVPEEYSLFGKIVNFKWSQTSKVYQDELFCTCN
LEKDQSVVVCDPKTAVMNSESDREMNNGKEINKNIHIRGRTRYARDTENVANNYNLDSYF
DSEFIQDSNFHGKSLPILSLAQKKESQSYKMCENSIKNNAGLNCVSADDIKNLIETCYTD
VQLSGSFDWKEASKLQTFKLCIDNIAKNSTLWIKNVTEQTSTNTTKTKVNKNLLKLCLQD
CHNNGKCENRKCFCNEGFEGEYCNVNSSAVPQNLRTKKICDFETSNCNLLLVEGKTFMKS
DKIICSFKNKTDSAWMNNVTAIFETFQTILCPSPYSNTVPLHIQLAVIIAEKHFFKQVDT
IFVYDSKCLNCTIENDSYKCFQKGGTCYINQECYANGNLNPSNCCEICNPSESNSTFTAR
RYESTIVASADANILIKSCSNRSPMTFRLQDPPNCNKIYLDSQISDNCNSMLDIYYDEND
IIVQLRECRVNPSICLFNLTLKDQCRGHELQKVNQYNFYWPGTGIKDECEGKYSQSEFVT
TLNVKVTEIVYEPFQASHSQSNDGASFEILKMGNAEVSVDVKGIVTYQAPSTPGREQFRV
IRYQNCVHQIKLVNVEIKENN
Download sequence
Identical sequences T1FRW5
XP_009011703.1.102002 jgi|Helro1|190317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]