SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|190380 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|190380
Domain Number 1 Region: 351-460
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-28
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 2 Region: 236-348
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-20
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 3 Region: 3-119
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000128
Family Spermadhesin, CUB domain 0.0065
Further Details:      
 
Domain Number 4 Region: 464-577
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000275
Family Spermadhesin, CUB domain 0.0051
Further Details:      
 
Domain Number 5 Region: 116-238
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000589
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|190380
Sequence length 634
Sequence
MLDCDKVLTSFSGNISSPHYGFWKTDFNCRWVINVTSEYILKITFTTFEVSKLTSSKVYI
KENNGVADTKVDSYSGTNPPILNRAYISFSNIVVVELENKKDSEVGYFALTYQSVKKCGN
DITNFEGILENNVTSDGFFEPNLYCEWNFKAPSGYTWNLTFQYIDMSLDVPSECINKLEL
YENVVSFNPTYTFCQRSTKVAYRSDNNLYKIVFSTSEKSEHRRKGFRLIYKMLNFSCGGT
LNATSTNQTFTSPNFPLPYETGVTCRWLIKGFKEQNVIIFFNTFQLLKTDLCRDESLSII
NIDNSEKLLCGESTTLPSFKSVDEHLTILFKSVIREENNLKGFNITYAVTGCSQEFRAMT
GRITSPNYPKEHRGNHNCNYKILAPSGTKLSLFFTDFKLEDDFRCEFDYLTVTDSSNRQI
KKLCGFYKPGPLFLTDNIASLNFQTDDQDHFGGFDLTYIASHGGCGGTLQELKGLFTSPN
YPNPPSTAYTCLWKIILPANYKFRMYLEITPTTASLKDCILEHSQLTIYDGPSELASHNS
YCKPEANKTLNILKDTILIKYTSTNSTDENIVFQLLYEGSLHFHINNNNNNYITNFNIYS
NAPVEGGNSYSTAPTPLSDDPHDGDDSGDDDDLF
Download sequence
Identical sequences T1FRY0
XP_009011927.1.102002 jgi|Helro1|190380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]