SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|190383 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|190383
Domain Number 1 Region: 111-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000749
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 2 Region: 440-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000212
Family EGF-type module 0.023
Further Details:      
 
Domain Number 3 Region: 241-299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000146
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 147-188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000274
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|190383
Domain Number - Region: 287-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000141
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 417-437
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00218
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 336-367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family Merozoite surface protein 1 (MSP-1) 0.032
Further Details:      
 
Domain Number - Region: 201-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0857
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|190383
Sequence length 493
Sequence
MQQALQFNVQLHSILLVDHSWHQDIIDFYVNSNGGNLVFEGAANKTIEFISGVDGNIFIS
GYNIKEIVEKIPQAFGTAKPYHYDQTITSINKRIDELEKIVQDMKAALIKDECSSNPCFY
GATCVNEFNGFMCICTSGFTGKLCDVDVDECVTLNNTDVGCFQPEKCFNFLGGFACECPP
GRYGARCHNTAGTCGSSSNVEMCGHGTCYPIYGDTSNRKYSCQCDPGWQTYYRVNNSACI
SDINECQSSGFYPCSEEPYVECVNTMGSFRCKDCPAGFYGDGRTCRDVDECAVNNGGCSL
EPLVSCQNTIGSFRCGDCPAGYKSGPINTCILLGVCESNNGGCHPMADCTPAPANVADGQ
LVKICTMHLLKICMLVCVLLNVLRDVWNITLPLQLVSHQKALVGCKELANVGTPTTAEMY
VCTCELGWAGPLCERQISRNCSLSPCRNGGTCMPLGDELICLCPPRFTGYACEIPFNGKL
FCFLLKLSYLIIF
Download sequence
Identical sequences T1FRY2
jgi|Helro1|190383 XP_009011931.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]