SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|190413 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|190413
Domain Number 1 Region: 434-639
Classification Level Classification E-value
Superfamily vWA-like 4.28e-35
Family Integrin A (or I) domain 0.00099
Further Details:      
 
Domain Number 2 Region: 639-823
Classification Level Classification E-value
Superfamily vWA-like 1.7e-31
Family Integrin A (or I) domain 0.0051
Further Details:      
 
Domain Number 3 Region: 206-408
Classification Level Classification E-value
Superfamily vWA-like 3.12e-28
Family Integrin A (or I) domain 0.0033
Further Details:      
 
Domain Number 4 Region: 8-174
Classification Level Classification E-value
Superfamily vWA-like 6.68e-27
Family Integrin A (or I) domain 0.0015
Further Details:      
 
Domain Number 5 Region: 175-210
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000407
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|190413
Sequence length 823
Sequence
MNVNFFHDYLLALIKDVASKLDIDSRWNQVAAVSFSDRANVEFYFTNFSTSASLQMAIDK
ISYGGYGTNLASALNLVRTSLFSAANGARVNDKTVSKAVVALINYPSDDPVVVLEEADCM
RNESIGIFTVGSGSILNRFELAALASSTKNMATVDSSRSLPTLSDPIKRFACGDDNNCII
NPCLNGGTCREIANQVICDCLPGWTGSFCNETCKNGGDIIFAIDASLGIESNTFFNVTNY
IGNIVNAMNINGNLDGPSFSRVGLFTYDGNSVTTYFNFSTYKTKSQIIAALRVPFQSKSS
SRIIKALETADLMFQREDRVNIPNYLVVVSDGDYDESNDGLKNLWLKSVSLREKGINILS
VGIGSAPYMSPQLTAIASNGRSNALIVADAQSLKENSTVSFITNRLCNNINYCSSNLCKN
PETCTSSVGNYFCGPCPSMTTGTYCERGCTGEIDLAFLLLSGGVVHRERFQNLTNFAISI
VESLDISPQRTRVSLIFWANEAQVAFNLNSYTNKYDVIQAIKLLPYFMAGGNNMSGALRL
LRRNVFNQANGDRPNVKNVAILVTNGPSTIDVNLTVPEAIQNRIDRNLLIPVALEANMFN
SFELYGIASEPKLSTLVKVEFFRDLPAKVPSILQTVCNDCNQRLDVIILLDISGSTEEES
LNNIALTKQIIYGLPIDNDNARVAMVAYSDDVSFQMTLDAQIRNKMNLINLIDFNAAAGK
TNTPAGFDAIINNILNKRGDRNDVPNYVVVITDGESNVNQGQTIPKANIIKNGGSIVVAV
GVGYTPNRDEIRGIATSDNYVFYYPPTKTAVEVANSILDKFCN
Download sequence
Identical sequences T1FRZ1
jgi|Helro1|190413 XP_009012032.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]