SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|190575 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|190575
Domain Number - Region: 105-160
Classification Level Classification E-value
Superfamily vWA-like 0.0133
Family Integrin A (or I) domain 0.017
Further Details:      
 
Domain Number - Region: 42-118
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.0555
Family Tetraviridae-like VP 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|190575
Sequence length 184
Sequence
MKFIATLPKAFIINTIIFFFFASWTSTVSARRFKRQNIDVTTSVDTPDSSETSTLPTTTT
TTITTSTTTTPTTTTSTTTTTTTRSSSTNSSINSIIGDLGPLKEVDVVLVMSRARSIGKR
VFYEHGRPVAFRLLRQYATVHPSFTRVAFITYAFNSTVVYNGITDRSKAMDKCAMFPPVP
DSNG
Download sequence
Identical sequences T1FS40
jgi|Helro1|190575 XP_009012701.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]