SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|190717 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|190717
Domain Number - Region: 76-109
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0116
Family Spermadhesin, CUB domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|190717
Sequence length 488
Sequence
MEMFNASCPARNILLFHLAKYGRMNVGRCMKSNYGQQGCSIDVTNFMNHKCAGRDFCLFQ
VPDPDLYKTHPCPSDFTSYLESSETKCPWVIEALPGQRINLTMHSVLQQLYKKFEQQNKQ
NWSRPKSSYSLNKQLYQYGADDSSSSNAILHTTTNNKACFEIGFVVDGAEGKRSITVCQN
DATRDHHLMLTNFHIIRIEFTDVHMLRELGIFILEFNVVGCPTLRASANSWQQKTGDSLI
VRCNSTSQKWHLVCRGNEWSGEVGNCSAGYSDSFNSWSLGQMFNAEDSFPFGVLLAVSIG
VAMGIVIGGFLLCLITLYLKRQRQNNPFSGGYSSPKEQQIQPRFQMTRLNAMNSESQPLH
NNWLVLDSRDCVNNSINNDNNNNNIRPATYQSSCMSSKVSRKAFQSPPIVLGLDDSFLDV
ANVIETENMMLADQQKIYHHDHPCLNNIHNSPQRYYSLKALSDMPKVNNADLLNFKEPPT
LYETSCFS
Download sequence
Identical sequences T1FS83
XP_009013117.1.102002 jgi|Helro1|190717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]