SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|190729 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|190729
Domain Number 1 Region: 694-890
Classification Level Classification E-value
Superfamily vWA-like 7.36e-33
Family Integrin A (or I) domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1205-1330
Classification Level Classification E-value
Superfamily TNF-like 0.00000000218
Family TNF-like 0.0059
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|190729
Domain Number - Region: 550-591
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00149
Family Pan module (APPLE domain) 0.054
Further Details:      
 
Domain Number - Region: 622-677
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00369
Family Hairpin loop containing domain 0.072
Further Details:      
 
Domain Number - Region: 1084-1167
Classification Level Classification E-value
Superfamily TNF-like 0.0278
Family TNF-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|190729
Sequence length 1330
Sequence
MHINSSDRTHQIAHNKFHLKIDYLKFQLLHQGYLKAQFWDPSFFAVHVGHYQNNQLLWFP
TSTCPSYVYVTTGAGSSSINAQPQGQSTDASCRQGCTADPTCLAYQVETNSANVQFCWFQ
KSSADLPNKYYQPNVIEYTKICSTSTSTSNICVTQYVQGNANEATSGAIPLATSSDQQCE
QACTNDATCKSYQLDSTAGAACPVIYEVPTPNQVSLGSTLRTSLTRKSCEGECSSNPSCV
SYQLEVNAGNVICWHQLTASNLAYTYVTSTITEYVKRCVKACTNKNFVESTSYVSRGATQ
TAGNAAQCRDTCFNDDNCLSYQVDNQGSCFIQRGLNPFVESNLYDKNPSITEYKKVCGVW
PIIVSTPTTTSTIIVPSTPTSSRLFTTPTPTIRTFSLTTSTPSTSTSTTTSTSTTTSTST
TTRMITTSTTQRIVPSTPSSGCFTYLWSEYLGNNVAGGTFNRANTLDSCKQACINLLPCV
AIDFDLNMSPAGCYILTTTGPRNYAPGVNHYDISRVDLGCTTKALPTTTTLSGSTGPKCP
SIVKMYGMNDDAGTQIATNIDEQECLARCNLDALCLSVDYALSTRSCFIHRIITGAQGQA
NSCCNRYIRCSATAPNYPNACLNDFSSTSNSSPDKLKSYMQIPSQNLDSCKERCLNTNCT
GFTYIDYTSSCYLFRGEVSSISFESGSTFYSRSFCIPDLPAPTTRECFVDLAMLLDNSGS
INEGTDVDNWELQKDFVQTVVSKSIRYGYYLDHLAIVTFSSNAQVVLNFTNYYSNFASLL
SFIKALPFAGAETNHPSAIKAGRELFQYANGGARPDQVPVMVMITDGSVSSQWRNMFSPE
VALLQITNIKRFAIGVGNKISMDELSRYASPGGVAWVPSFSQINLAFNNLTLFINQFSCK
SVTQTGVPTRVITTTTSTTTTTTRQIMTTTSAQSFPQTGTDCTFGVALNGMRTGQTDPLL
VDVVLANRLNGWTQNNDQCRMDLDSSFNFVEICAGIPPRATARLQTKGAYPSPIGFDWLS
TMNDGLETGCRSAVAFFTKGVTISLNLLSGSVVSTNSQTAWSSFSITNSMYNNKQLFSGF
SNERYSEYQIIRFPNPYVNPTDNIFNTADNTYACKSNTNYFISFSAGVSAYTQAQMVIEG
LDGIYTAQRMNTNTDGVTTMSRSLFLPCSSTIRLVNNYGNIEPGINSNLISLVIFPYGVM
QGTSAAWSAYRSSNSNAADPLTFDQWRISQNVGTSNNAIVTIIIRGYYYIYASIGAPAAQ
KTSVSLRRNNGVVFNIDRLSTNSNGVDILGHGAVILLEANDVLKVVVESNGAITSNSYGY
HTSFFGFLLY
Download sequence
Identical sequences T1FS89
XP_009013175.1.102002 jgi|Helro1|190729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]