SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|190776 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|190776
Domain Number 1 Region: 21-131
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.39e-21
Family Synaptotagmin-like (S variant) 0.036
Further Details:      
 
Domain Number 2 Region: 145-264
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.51e-19
Family Synaptotagmin-like (S variant) 0.014
Further Details:      
 
Domain Number 3 Region: 297-480
Classification Level Classification E-value
Superfamily vWA-like 5.12e-18
Family Integrin A (or I) domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|190776
Sequence length 829
Sequence
MSSLLAKRLASDPVSKIELSIRCNSLMNRDVTSLSDPCCVVQLMTGPNVFTEIGRTENIK
NSLNPVFAKIFQVDYYFEEVQKIRFLVYDIDNSTQTLDDDDFLGSVECTLGEIVSNSPYS
KPLFLKNGKVAGKSTITIRATEAAQSSEILLLQFSAKNLDKKDLLGKSDPYLEFSRRTKE
GTFQLVHRTEVVKNDLNPRWRAFEIKSSKLSGGNIKEQVKVDCYDHDNDGSHDFIGSFET
TVEEMMQASSKVVQWPCINAQKRAKKKGYQNSGVVMLNSCKVTKEFSFLDYVFGGLQINF
TVGIDFTASNGNPNTPQSLHYMNPSQPNHYMRAIQSVGQVIQDYDSDQMFPSLGYGARVP
PNMEVSHCFALNFNTSNPFCAGVQGILDAYRMCLSRIQLYGPTNFSPIIYHVAQLAAASQ
KDRRPSNYYVLLIITDGVISDMQDTLRAIVYASALPYSIIIIGVGDADFQAMDILDGDNG
VLRDSSGNVAKRDIVQFVPFRNYERASPAALAKQVLAEIPDQVVKYFRMNNIEPEKPKPF
DHNAVKMVASANQATTQQQSMYPGVSSIQQTAQQSSTNPPSSQPSTTLSQQPGYNPAAQQ
QQPPAAYPSQGYSGQYPAHQPPQQPFSPAAQTMLNYVSHQSGYQPSQQSSQGHYPGSYPP
AQYPGGYPGQYPGQPAPPGYPGQQTGAPYPSQGAACPPQGASYASQGQSYTGHSASYTGQ
GAPYPSHNQPYPAQSAPYPGQGAPYPVNLFYAFDRVGHVWLSSPSLFHGIVRKDEIEVIE
NNIQKSILETIRRKLVTGESEILEICYSTCCSPYCCLLFADGDVNINSG
Download sequence
Identical sequences T1FSA4
jgi|Helro1|190776 XP_009013517.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]