SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|191173 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|191173
Domain Number 1 Region: 35-213
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.88e-21
Family Laminin G-like module 0.0044
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|191173
Domain Number - Region: 2244-2282
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000146
Family beta-sandwich domain of Sec23/24 0.032
Further Details:      
 
Domain Number - Region: 2964-3018
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0863
Family beta-sandwich domain of Sec23/24 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|191173
Sequence length 3119
Sequence
MKPLMMKALLHGQAVIFTIIFANFASIQLISASLTATFQSNGYASLPWRKSSTTTEVTMN
IRTNQRTESMLMMAIGSRDYFLLTVNRHGGIELKIDLGSGEGRLQTDREVVVNDGRWHRV
NFNRKLRNLTLAVDHTFHVRSVGGGWGCFGEGKYTQLDVDKYLFIAGTTASFILENSKSS
SSSSNGSSDSRSGGVYNSFVGCMRDVVVDGERVLETAMESQVFRSPCCYGITWEKCIGEW
KDADGSGVDGKKVASTGGGSKIGDDDDEDDVGDDDDQSEGSDDEESDLNNDIIGIKNSNP
NNNNNNNSNNNNNNIDPQSAALRQHSTEVVLDISGIVNIGRQVTKNINKLLDVSGNQRYK
QISRDVLSFHILELPHCGVLFKKLSATSNKMTKRKKKKRKNKLKTQEENVESFKNYVTKD
KKKRSKSKKIKIEPLDRHYLAREEVLSWKEVKMLHYEHGGSNFWNDVIVINIRLNNNNNN
SKYNNNNDQNNNITDNNKNDRTPMFVDNASQTSYDDDDDDDDYDSLNDNYGNMYDVARVD
DIYDRYLNSDGIYNNIIINNNYNNNINNNDNEVTSLDSIFPLTLTIHIRITPPSAHPIIN
KLGLEGKLLLPRWSKCLMTSQTLQASSSQSNHLQWHVVHAEQISDLIVEGNRREVEENQS
NFGYFEVTDRYLRTARRTDVFSQDDVNEGRVSYIHAGTANQIVGFTVTDQSGTSPMQFLQ
IHTIPIKLQPISVKGIIVEGRRKVIRSNNLAFKMAPDIKLDNYCGNSDIDEVDEESDDDD
DESNNSGENDDDDGILYDVIKRPKNGVLQRFEKLSLKTLRRKIFHETGDDDDDGHNGYRG
LYDKNDDYDGEDDDDDDDDLWKAVDSFSQRDINEMRVRYVISDVTALQSSSQSTREDSFV
FRVKNFRQRSHQEPNNNHNNNHNNNNNKTYTFNITILHQNSTLTIVSNQPLIIHLTINNI
RDVTQSNDVIANHVTGKNLLLKSTVSRSVRYELMKLPEFAGLTLSHQELALSSFLGQNNN
NNNNINNNNCKTNFLPLKLYSTLTQQHVNKRLLTYCLNVTKIKIYLATNYNYNSDNNNIN
NNINNIDQRHRSILKKQQDTSNWNAKHVPVDRRRTKIMEIKVEDGFKLRGWDKLWNLDAT
VDVIVNVTWNENDDEDFGEDVGDDEPRIYLTIYDLLADELSSTIMDEKTIVVKFRRDDED
AGASRERNKNINLLSFSFKLSLFNLSSSSFFPPSPSPSFDHDIENDLLFEVVKKPAYGRL
LKRVEKDGGDESASGMNRHHHHHYYHQQQQQLLNNNSKHLHRHHHPLHHHQQLQMVANDD
DDDDLWNDDSLMFTMRDLKSKKVFYKHTTGGSNRDEMKLKMKYMNEDVGTVQVSVEIIQN
VVPLQVQPVKIDEGSSVVLSEDVISVGRYHLSVGGVLIVVLKPPSHGVLFKVNQLMTNHR
YCLAQVHYDCMFGPLALKQFALDYPTPLDKEVLEIRDLDTEPGDLVFEILSHQPLKLGDF
KSRRGQLLEKFSMRDVYEGVVSYVPRGNLLRDLPMDSKKGYVDVKVRDLGNHSLYLTISI
IFPSPRFLLDDIRVYPGALQPISNESLKLMMYDDSNYTGIYKHLSPRSVKYHIVTSPKYG
RVMTVNSMNAYNLTSFTQLDLDRSVIYYKHIHTESDSDNFMLKVMVPGMESIYSDVRVCV
SVHNLNRANYRYVLTMRKVNVRTNGSITIKSYYLNVNRPSHPNKFLNNIINNNNINNNNI
NNNNINNNNINNNNNNNNKNGYKEASRYDGLMLMVRKLPRHGRISFKGRMLTMNNNNNNN
NDNGYNLKYFDDGADSSLIDYRKVLITQSDINEGMLKYHHTPSSSSLSSSSFSSSSSSSS
SSSSTIDHIEFYVVLWKPELPSNAFWNKCFRSDGGVGGGGGGGGGGGHKGGGDDDNEDID
DEDDDDGDGEAFDLDFNNSTASKNGRIELLPHFPISSSSPSSSSSSSSSSSSSFSSSSSS
SSSSSSSSASSQSALLPVHKLSSLRMTIKIWPGNDDNDSDDDDGGGDYDNDDGDDDDDDD
DDDDNGLEDCKWSSLRFQNWKSVWEIVDGGWMVLQESIMKVLWSGRAMKNYDRNNNNNII
INDDDDDDACDGDDDGGYNDGDAEGRNEDVVFKLTEHPSVGRFVRLPASLQNSSSSSSSS
SSSSSSSSSLLLTRDLLESQPPITSFTQSDVTNHVIIFLLNNNAHNNNNDTVDNRRSKNV
DNNNNNNDNKNIERYSDLYAYNEKHQQQQHQQQHQQQHQQQHQQQQHQQQQHQQQQTNAA
NTDIIYLSVYRTSKRRDTINDNNYNNDNNNNNDDDYGDVTYRRVGTSSSSSNTHTTATTT
TATAATTTTTWKDNNNHHLNIRSFHKVIHVKIIPLELKVDSIKNITITQASFYATFRHSH
FRFQTNAPYILPEVTVHLQMSFRQGLLVCGSRVCSSFKMRDLMLGRVVYVQKNRSANFDS
VLLTISCFEVLLLDEPLNVLVRPLLSSKPLVVYRPLQINNEWIDLNLTHLNATSLAHVTN
DDPIFYIIRPPLYGWLRVRLKKFVRSRRHADDDDDDASDNSNYTSDDDDDDDDDDDQMTK
VDNLYAYCCREVQADPTTNNNLTDVHFFHFRHSDLLLNHVQYKPDPNKYLGQWSDELTYI
VTSWNVQPAEGRLKIKLKRRNDDADDDDDDDYYYFGYDDDDDEDSANAVHNANASQRLET
NDKKYTSSYPKQRNNINNKFYNNTNDMKDDDDDDVSPLDLNMRRFIMIGMLALLFLLLVV
VILIIVKCMCGCGGKKKRAATTATAAATAAATAGASNRISASYKAEDRIDDEMTHLSCHR
NDDVTNMNNNNNNMEMMECDVNSRKIMGAMKKMKSDGGSCSDARCDPMFSSTSVGYLVPV
RSSNDDDININNLHHDSFHPDTSKYISPSNISDSNRSYSSEHIYDEPPEHPCRRHNHLAT
STPTTLTECYSQQPQNERRQSQYVEQHQQPQTHQPQMNEQLHQLPPSLPPHQRQLHQQLQ
QQQLQQQHQQQQHNEQLPSYVTFVDHDFNNEVLSDFYNNNDNNDGDDEISCAGDNMTNEE
KDDVINNNNSSNNNNNSSSSNNDQPAEHQGIFNWKDIDPELLAHCRLTNPLLYDQQYWV
Download sequence
Identical sequences T1FSP6
jgi|Helro1|191173 XP_009014790.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]