SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|191274 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|191274
Domain Number - Region: 129-260
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000236
Family Spermadhesin, CUB domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|191274
Sequence length 425
Sequence
MEVKEYCHWETFQPECRSDEVVVFASALYGRMRKGKCIKTDRDDIGCSTDVRRMADSRCS
GRQTCCIVIPDRMFDSTSPCPEDLKVYFMASYMCVKATATTTTSTPPTTTLPHPYNELFN
DNNDNNVQNRGFISSWAAKNNKSGCGTLSLPWIIKVKPGQKINLTLIDFYYNSSIANEFN
GGDVINRHYTDSLKSCSQVIVIIREPTTAIRSQSVCHFQNQGVRNIYVTETNLVEVRVIA
PNFTEEMGHFLVKYKAIGCPDLTPPATTTSSSSKAWWFRSRSNSDQSTFGCVGETWKRDL
TCVDNKWVRMKKSSSSNSGGGGGGGISRVGSYGEDSDGISDDDDDGGETIWSDGDDKGDV
FWRKCDKETSKRWHDNDSYNDNGDDDQNDEEDDNDGKDEDDDYDDDDHNFGSLITFSSVK
LRIKY
Download sequence
Identical sequences T1FSU0
jgi|Helro1|191274 XP_009015092.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]