SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|191283 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|191283
Domain Number 1 Region: 268-395
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.45e-18
Family Galectin (animal S-lectin) 0.0092
Further Details:      
 
Domain Number 2 Region: 28-125
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000331
Family Galectin (animal S-lectin) 0.013
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|191283
Domain Number - Region: 149-274
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00118
Family beta-sandwich domain of Sec23/24 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|191283
Sequence length 396
Sequence
MASSEAHSTPFSPKLSHYQCNEVEFLRLQRDIVCSIALTFDSKGITKVSRSSFIHGVHGR
EEKDSSRFLPRPTDVMEMIILVTNNCFKCSFNGRHTFDFIHRCPLSSVHAFKVKGHVDVM
KIFFQDPHSMPRRLSAPSNNTNQSVQFDSNRPTTNTTNGIHPSQEQQRLQQQQHQQQQQH
QQQQLATDATKSLGATSSYPPSTSSGFCSVIFPPFASSSSLSLSSLSSALPPTSPSAAAA
SWLSSSSSSLFKQSFITSPAIAKKAKVFSFPNGLHHSQVITIYAALHASCQWFKICISLS
EHLDDHSLIFYVNVPEKVVLRSSCKRGDLGTSEVEIPGFFPFLPNSYVCIYIQCLDDCFN
VAVDNRHFVEFKRRDFYLSECKCLLIKGDLIVSHVI
Download sequence
Identical sequences T1FSU3
jgi|Helro1|191283 XP_009015119.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]