SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|191307 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|191307
Domain Number 1 Region: 102-217
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000113
Family Vibrio cholerae sialidase, N-terminal and insertion domains 0.059
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|191307
Domain Number - Region: 1420-1464
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00186
Family Fibrinogen C-terminal domain-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|191307
Sequence length 1615
Sequence
MASPAACGNKSILLIGLTVVVLSFVCFTDGFASQRKKILDPKKTYDVLEKPEPAKEDENY
VTYYDNGTCGLPYHFVDESLVEYEAKNVIGLDKATKAMKLGTSFAVIWTFKTTEYSTTLF
RMFDNDQNLSFQVKYESPRKIGVFYREKKKPGRWITNSKPTPLPLNSDHFHTAMVVFNNG
DVSFHVNCSLVDEVKIKKGYKANQLDIGSSSLYQFGGTLSVETGERYDTLNVVEHGPQGP
PGPKGETGYPGRDGFPGSIGLPGPSGHVVIIPLALRDSAKGPSYELETLKSRIDNHMLAL
NGAPGGQGFTGLPGQPGDQGLPGTRGEIGEQGEQGPSGPRGSPGIPGPSGKTGAIGNTGE
RGAPGVQGLPGDAGFVGPQGLCGVKGQRGAQGPVGQTGQVGKDGEIGHAGPQGPPGPPGE
HGPRGYIGSAGPPGIPGLPGVPGSEGPAGQKGSAGPIGLPGKAGSIGSPGAVGSPGSPGP
NGLTGPQGAVGKPGKPGMPGIEGPQGLDGMQGPAGEKGETGPAGMIGAPGFAGAPGAKGD
IGQRGPRGNTGEQGYPGVDGIRGETGRPGEKGEKGDRGVPGDQGPSGPKGAIGGRGKPGL
LGARGEKGHQGEAGFPGVPGAPGEKGNRGNQGDFGKEGAKGNRGPVGQAGERGLLGPQGA
RGPRGKAGPTGNPGPKGDIGPQGLQGPQGEQGTQGPQGPVGFQGPQGPTGPQGKDGAAGF
PGERGEAGIPGAPGQVGPVGQVGQPGPPGEHGLLGERGQQGYPGPAGVRGSPGETGKEGP
AGPAGLLGLPGSPGQAGPRGFPGKRGLPGLQGTTGLIGEPGQFGHPGRQGEKGAWGVPGE
AGPQGAPGRPGQPGPYGPAGGKGDTGEPGPTGNPGKDGEVGLPGAEGAPGPVGRPGVIGE
KGDVGKHGMKGEKGDAGEYGPPGFPGAPGVPGPHGPDGPQGDQGERGIPGIAGIKGNEGP
RGFRGPAGLPGVQGPPGAPGSKGDPGETGPAGAVGQTGPAGPTGATGAPGAPGEPGPAGP
DGKQGQRGDPGLEGAPGPAGADGASGPPGVDGAKGDAGPTGAQGPPGPAGARGKVGGKGD
PGQVGFPGVPGHAGSPGEKGEPGAPGRAGKPQKLGKPGPVGIAGDPGPPGPAGKEGPPGP
QGPQGENGPVGPKGDRGETGLAGERGPDGAEGTPGRVGPRGEKGQPGAMGEPGSTGVPGA
AGKEGPAGPLGPAGPKGDQGKRGDRGHQGTLGPTGLPGPVGQKGDIGPSGLEGTAGEKGV
QGADGIVGQKGDPGELGPPGPPGPPGAPGPAEDDFEAIQYFFGHDYTDLEDEDEDEDDEE
NGDEDDDDDETQDTEPLKEGEAIRSKRSVNGKQQRARQRRSTTEAPTTTSTTTEAPSSRS
KDRLTEEKKITLAAAQVLNVVVDLREEIKAYKEPTGTKAQPARSCRDIKLVRPDSEDGWY
WVDPDLGNPNNAIHVYCNMSTNGQTCVYPQTPSVPTQFFPKDESEDKWFSELPGGHMLKY
ADDVQMTFLRLLYTKAQQKFTFKCEKTVAWYDSANKNHGSAIALLGDNEDELETKNFDRS
AVVDDGCKSRDSSGSTVFNYVTSKTSQLPIVDFKPKDYGKPQQQFGFELGPVCFG
Download sequence
Identical sequences T1FSV3
XP_009016121.1.102002 jgi|Helro1|191307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]