SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|191318 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|191318
Domain Number - Region: 7-118
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0257
Family Clostridium neurotoxins, the second last domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|191318
Sequence length 232
Sequence
MFGATVDSHVMLTLKKFLADLRHYKVSMNLKTYHNEGLIIYINNINNNNKKNKNNNIEDN
YNNINKNNNKKIIRKINNNNKFNWVDTNENNIDDCQPISLLVYMKLGHVYIHLKRQRHFY
HHGDVDDADDDGGDPVYNDDFFHGDDDDEDGVNLKKSVGVYNDGNWFNVNLNVNESVYAL
NINNTEWMSVTANNNNNHNNNNHNNNNHNNNNHNNNNNDNNNDNNNSNEIRR
Download sequence
Identical sequences T1FSV7
XP_009016136.1.102002 jgi|Helro1|191318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]