SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|191346 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|191346
Domain Number 1 Region: 301-528
Classification Level Classification E-value
Superfamily Kelch motif 6.02e-46
Family Kelch motif 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|191346
Sequence length 615
Sequence
MKKNENDAESNDGSTGEQIVLISKSGGGHQVDRNMLLRTSGYFHGLANSGMRDAHYRELT
LECLTDESLIEVKDYLSKLSTNVMENGGPHLKSLNEVEAGLDGAFYLLINDMIDGYIELL
LKHLDESTCIRVLDIANKHVLINQVVKKVIKYMSKNFKEISERSKTLLSPDEMFYLVASE
EINADSEIEIFNLIIKWISEDQSRKCFAEKLLTEVRYNLMTTNEKQKYTAILHDLNLNIS
CSKDKDSNISRTVGMLFVIGSTEKKHQAKSFFNILPVYDFVEASTISGDGTEPSPIKFKP
SRRKQPPFDSFCYTACVVDNCLYLIREETRNNMISRESFVYNPVDAVWSKCPNMHLPRRD
FYLGGLSGHLYAVSGRTRHGLTPTVEKYVPSENRWYMVEPIPLAVTSLAGCVCNGMMFVS
GGADEEFFAQNQVYRYDPSCNKWFSRAPMLTARFSHVMTCTENKIFVVGGKTEAYESEPF
DFLKEEIMDGEMYDVESDQWSSVLKLKLPVCDLPSITINNFLYIFHDTSCLLIKLNLGKY
LKEKKTSNVSSSLSVQDRNANNNNDNLVTNEAMEQNSPCVGAHPDDDCQILTFMNHNGKT
WFDCRYFGVMLMSDV
Download sequence
Identical sequences T1FSW9
jgi|Helro1|191346 XP_009016255.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]