SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|191549 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|191549
Domain Number 1 Region: 132-231
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000228
Family Cadherin 0.0039
Further Details:      
 
Domain Number 2 Region: 596-705
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000238
Family Laminin G-like module 0.044
Further Details:      
 
Domain Number 3 Region: 73-139
Classification Level Classification E-value
Superfamily Cadherin-like 0.00002
Family Cadherin 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|191549
Sequence length 1128
Sequence
MIFCAIKFSFFTLLIGIARCSENQASPKSLYGTIKENSQSNQTVDFNVPILSTITGQQVC
TYKLEPKVEKGPNPFIVELVNSTTGQAIIRLARGEVLDHEVTNNYVLILTAEFCGGPIQT
SKQELNIMVLDVNEYAPEWTTTSYVVDMEEGKLYDNILKVKAIDKDGLSEDADVCWYHLL
TPDVPFQLDNKTGILRNTESLDYSSRHNYILEVVAEDCRGLKSESIFVNILIKKKNIHYK
MTAHKAAQLFPRSSASLNICDVTNCSVEQVSVSMKLGKPRANDGSGGDASNDYEVLSEID
RTCDMDDASVKRRVSTCDLSEDTIEVLTVQHIRQLSKNPNNHNKNNNNNNINNNNNNDNN
NNNDDDDDGYYFDGKTAYDVTGINDVMDNNNNNNNDDDDDNDNNDNENNNNNNNNKASSS
SFLMTKSGPRSKFTISTWMRRSMEEGLDAGNSKQSIVCSSDNDGMSRSRISLYLHNCHLV
MLARFEPSKDPAVKEVNVRRRRRRSTSTDDDNNVNNKDAGGKGDVIANSDKKNDNSKDGD
SYDNGDDSREWVKYSGNNDNKKGGNDVTNNNNNNGDDSDVTDDNEEDNYDEKAFYRHSEW
HWKLDQVCDSRWHHYTVMVDQDVARLFVDGNLFPETQRNPFIIDDRALHNSKRVHGTKLT
VGACWKGLTGKYGDYLKGHLAGLLLSRKSVGSAFSEQAVRCLNNCNEKLDFHSVNQMESG
MDFYFILDFNFVHPFCTFRCTIEIKSISMNSQMTELTINGRSKESVEHLISRVAYINPRL
MTSSSSATAPSVVAFQTSLKEDTTVRQVAMDNIKITFNLDDDEEVSEDNNNNGGESEPLL
ISGTEQLDVVDDDVRRGVQIFRDVLIYPFPLDDDSYGDLEKEAYLSNEIQSCNVRIFPEL
DDDVDSLIYSNQLVHSQHLIVNYTPQEIVIKGPGKVEDFMSVLKKMFYVHLRAEEVNEKT
FHLVCYHGGRSAIVVITVVLCAVVLLAVITVGTYRMVTNRPKTVRVHVDNEQDLQWDKST
ITITVNPLDVTSAADALDDDDDDEEVHKDDNNRNKNNNKNDVINRCDDYENNNLHVAGND
YADDDDIGSAHEMMKDDDDDDDDGRKVADDDDDEDVSKINHLIISDTE
Download sequence
Identical sequences T1FT25
jgi|Helro1|191549 XP_009016941.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]