SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|191649 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|191649
Domain Number 1 Region: 206-301
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000102
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|191649
Domain Number - Region: 332-355
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.055
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|191649
Sequence length 390
Sequence
MFIIIIITYNIIIIFSLTLTLKLASSPSSSSSSFLSSKNNNIKNVNRVNFNNINNKSGSR
TGNRSGDSFPVGSIHDYAILKIIRNDRHQKHQQQQQQLPHQQHQQQMMSPGNHVIVVMLT
QMLEPEVDADGGNDDDDVDGGGEEEEEEENDDDGDGQTEKGVMKRREKKKKEEKTYIHFE
LEYSFVTDFGIKAGRQRLIVKSLQGCYFNFDSRQKTSGTFHSPNYPNSYPKYTDCYFIFA
RAPNEILKFKFSELHIDGTLNCDNDVSDYLEIFDQSSQRKHRICNHQLEKDKQITIRSTN
NNNHNNKSIHVNNLMNNNLKHSPSSDDDNNINDVIITFHSNHAYEAKGFNAEYHYEKSAS
AGNIQRSIKGSSLFVSYVVMALVFTLLINK
Download sequence
Identical sequences T1FT63
XP_009017189.1.102002 jgi|Helro1|191649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]