SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|191777 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|191777
Domain Number 1 Region: 128-280
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000000264
Family Galactose-binding domain 0.049
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|191777
Domain Number - Region: 563-609
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000151
Family EGF-type module 0.0084
Further Details:      
 
Domain Number - Region: 529-579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0686
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|191777
Sequence length 753
Sequence
MTTLYMRVDIFSIQTGSWWMWFMHTKLNIILYNRDSCTNGCDYRMNKFIIGLTNTFDPQV
NQSIRGKYDLCGQWPADVLFPGQPMRINCSDGNKFSRFVIVQQSLEAEQTDKFLAFSELE
VYANDKFLQYENVALYKPAYLSSTLSKRYPNYCVDGKKDTYCQLAIESPPYPNWFVVDLV
GAHQVQYTILYARADYYDIMDNFIVGLTNKFDPKINKTIRGQYDICGRWSTAASSSGQPM
RVDCVNKNIYYRYVIIQQDVKITLPTNAMTFVELEVYGFENLATKFFGCFKSFQTITSFN
DTSVGACLNICKRFNFQYSSVKEDRKCLCGDELELFPPTAACFSNFVYLAKPLALKPIYL
GCYNDNSDRDLFFGSNLETLESCFQYCLQNNFTVAGFQYDSYCFCGFSFGKYNRNLESDC
SGFSNSIYFFCETFGLNKSCSDIYHCSSQANLGPGMMCPSQICEPGWIGDSCNERDCSVN
NGGCGIHECVLFEIESTTITGCICKTGYTKSHYNDDCLDLPNNITTKNNKCADGRICPVH
PDPCLQKNASLDCQCSPGFERTNNVCSDINECLNDSNACNSATSACVNKVGSYGCMCFTG
YYNKDLYTCEVYQEKKDVMIALVVVSIILLITIATSAAYFIIRKKKFAKPSRTNNIEANV
IQTPRPKHQNADVDADYGTIEDVYDSTIANNYSYFGLTPVEDRPSIAVIHVVAYLKGVLP
MRGRIFDWNPLEWDTGIPWNGIPVSHFDGNPIP
Download sequence
Identical sequences T1FTB3
XP_009017721.1.102002 jgi|Helro1|191777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]