SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|191792 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|191792
Domain Number 1 Region: 193-381
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.02e-44
Family Astacin 0.00025
Further Details:      
 
Domain Number 2 Region: 509-619
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-37
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 3 Region: 833-938
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.05e-32
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 4 Region: 664-784
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-29
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 5 Region: 942-1058
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-24
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 6 Region: 384-511
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-22
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 7 Region: 618-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000062
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 783-825
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000213
Family EGF-type module 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|191792
Sequence length 1101
Sequence
MFTGANNLQALKRNKQNQIEKRVDSNQTNARRQVRRNKKTRDHLAGRNHVVKTRKKNFRN
DTKKAKRKKLSKKRNRSQNNKQASYSQMNHLRTVRKKSGKQGKQVNKEGKLKSKNELSKA
KQPPTKKSSNSTNIKQTSTPLQYKRIIHNSFGRNKNYFTHKKKKTSAEDEDDEKMLDDDG
NVVKRRGKRAATAKYDRLWDYGVIPYEIEANFSGAHKTLFIQAMKHWENHTCITFVERTA
TDASYILFTEKPCGKEQDPRPSPSGRIDKFGIVVHELGHVIGFWRKHTRPDRETHVQIVF
KNILPGQEYNFNTLTHSEVNSLNEEYDYLSIMHYARNTFSKAVHLDTITPLVYQDIRPEI
GQRIELSPGDIVQANKLYNCPKLIKCTECGDTFLEASGTFGYPWNAKRYMRFIDTNAVCA
WRIAGSHGEKIVLNITSFDIPENPNCSTDVLEIRDGHWVKSPLMDRLCGLKLRLPYQLIS
SDSRMWIEYRRTLRSLHARGFTARYEAVCDGKIAKDSGLLTSPHYPDSYEINKKCTWHIV
VPHGYTVALKFQSFEIEHHDKCVYDYVELRDGDVEMSPLIGRFCGHKLPQPVESSTNWLF
VKFVSDSSVVKSGFAAHFTKEVDECATNDHGCEQICINTLGSYHCDCKLGYELHSDGRSC
EQACGGILRTHSGSISSPSHPHFYPNNKTCEWEIIAHSGFQIVLFFDKFDLEGNNCCMMR
DLQEDCEYDSLVVKSWNATNTATHGPFCGTTAPRNITSIAHMMRVVFKTDGTVQKTGFLA
RFETDKDECAISNGHCQQICINIIGSYKCQCKPGFVLHENEMDCKESDCKHELSGRDNFI
KSPNYPDYYPQLADCTWLFRCLEGHRIKINFLDCDIEYHADCNNDYVDLFDGWNTTAPRI
TRFCGGRPPNPIEASGNVMFMRFVSDKSVFKKGFHANQETVCGGTFEATKKAQNLYSHAK
YSGSNYEAMTRCQWQIVAEKHHRIRLKFLTFQLEEELVCKYDNVEIYDVDHEGTEQLIDT
SCGSRIPPVIISHYNELLIKLFTDDAIDGKGFHATYEQIPHNPLHKSTWQKNIARSRRAR
RNQARKNRQQQRRKNLSNAIH
Download sequence
Identical sequences T1FTB9
jgi|Helro1|191792 XP_009017824.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]