SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|191819 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|191819
Domain Number 1 Region: 14-214
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 5.23e-35
Family Integrin alpha N-terminal domain 0.0000947
Further Details:      
 
Domain Number 2 Region: 365-477
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000000000575
Family Integrin domains 0.0084
Further Details:      
 
Domain Number 3 Region: 517-711
Classification Level Classification E-value
Superfamily Integrin domains 0.000000154
Family Integrin domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|191819
Sequence length 781
Sequence
MAITTARINNSLHYVIGQPVYHDILGKLWFTTRQNTSECQTNFELEEELRTKHPRSRYSY
YGSSLLGMDVNGDGRDELLVGAPLFSEKNYDEGIVYVYSFHANGTLSREVVELHGSRRAW
SRFGSSMVDIGDLNWDKYRDVAISAPYEETGVVYLFLGSQDSFEVQFSQRIVASSINANL
NGFGYSLAQTFDDLGYSGLLVGAHKSNMVVRLKSKLVHQVNVSVTFQEDRIMWNHLQCTK
SFNQETILPINLNFEYFTYGHERQIAAYTLLIDSKFRRGYHSNEKVQTVEGLINFRETCG
QEKRVSHQWNITFPINAQPQNIKKGVTFDVTWFLTQLSTSNSVLSSNNTSYSNAIMFAQD
CTEKCQPRLIPRSLNGMDGKLEYVHGSKDVLQAAFLVENVGEAAYNAQFDFSYPTFLFLN
KIIVERSDCNDVMCEKVNSDPSNQQLKCYFNRPVLSNSSVRFNFSFNVQSHPNAADTNNA
LHLFINDKKSSIYLEPLYSSEIKIFNGSRANALLADVEEDMTFAVTNVFDVRNVGPGVHP
GFNLNIRIPIFEQSAEKNPQCCFTSSMKISMKNGTSVQIRDAMENVTIEKPPPPSNSVDV
DDPQKNPNSIFNMNCRTSSCTVHSAEVASLQANESFSINITVSFSHSLLKHLQSYTMFQY
TSHLDINCIKLLVGVRNLSLEDTGCLKGGKYQAIYISNPVAARQSIPIWLIVVCIILGLL
HWVMFVFVLKKCGFFRRASHERLIQEKRDAEENVNGEENLSCPKNKKKFDANLQTKCEPE
Q
Download sequence
Identical sequences T1FTC3
XP_009017914.1.102002 jgi|Helro1|191819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]