SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|191885 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|191885
Domain Number 1 Region: 30-234
Classification Level Classification E-value
Superfamily vWA-like 4.26e-21
Family Integrin A (or I) domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|191885
Sequence length 970
Sequence
MVRFKSEVDSMFIRQTVVALLLLFSFNGPTNFAQQTQTPCGGNLDVILLVDTKLYLSEND
WTLTKNGLSNIVSTIDRLYRVSPSGTHVGVGFYNSVGFVTLSVGSGTSTSVVQNAIQAQS
YQATDQQISNLKDGLRAAMDDFASNSRNVSQPFSTTMVLIVFINSRMDDESATVIQANVL
KYRNIRILPIAISPDVPLPSLRQIASSPSSVQYIPYQNIGNAWTSLSSLSSTFCPTVAEI
GRPGDTGGTGATGIRGNDGAQGYPGNPGYPGPQGSPGILGFTGNPGQPGPSGPNGQPGPS
GSPGTPGTPGQPGTPGFVGPAGPPGLPGLPGLPGGPGTNGQPGSPGPTGPTGPRGQNGQN
GQPGFPGIQGVSGQPGEPGFPGQQGGQGNTGSSGAQGQPGSQGSTGSPGMKGPQGATGPA
GTNGAPGLQGDTGSAGYPGSPGPLGQPGLQGDTGTPGGTGLPGPVGPIGPAGSSGLNGPP
GPPGPQGPQGPQGQKGTSGDTGPQGQPGGIGPIGQPGFPGFQGSPGQPGSKGATGPSGID
GQPGPQGQQGYTGTTGSTGQSGAIGPVGPQGSQGAQGNTGPSGPLGQPGPLGQPGQPGSV
GIQGSPGPLGNPGPQGLQGQSGLPGTVGNTGFPGPTGFNGQPGPVGAPGSKGPSGSPGPL
GNVGQPGPSGDIGLPGSTGLPGSAGSTGATGFPGLPGATGQSGFQGPLGPAGPSGNKGSP
GDTGAPGQMGLAGPQGATGFPGPSGPIGQPGPAGSPGSQGPQGAIGPIGSPGISGQPGQP
GLPGLAGQTGQPGPAGSAGSAGQPGQPGEQGFQGPSGPAGFPGPSGDLGLPGPPGSRGPQ
GATGNTGFIGQPGPVGQPGQQGPLGPAGPIGGLGPAGQPGLPGQPGQQGPLGPQGDTGPS
GPAGPTGNPGFVGDTGSAGPLGQQGSTGQPGPLGPAGQPGPIGQQGPSGQPGPAGPQGQQ
GGIGPQGPPG
Download sequence
Identical sequences T1FTE0
XP_009018142.1.102002 jgi|Helro1|191885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]