SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|192596 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|192596
Domain Number 1 Region: 2097-2270
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.15e-31
Family Laminin G-like module 0.0024
Further Details:      
 
Domain Number 2 Region: 2264-2457
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.32e-29
Family Laminin G-like module 0.0089
Further Details:      
 
Domain Number 3 Region: 1276-1294,1911-2084
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.18e-27
Family Laminin G-like module 0.0038
Further Details:      
 
Domain Number 4 Region: 2678-2863
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.73e-25
Family Laminin G-like module 0.0034
Further Details:      
 
Domain Number 5 Region: 2510-2669
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.68e-21
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 6 Region: 698-748
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000114
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 7 Region: 1112-1165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000212
Family Laminin-type module 0.0031
Further Details:      
 
Domain Number 8 Region: 1062-1114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000558
Family Laminin-type module 0.04
Further Details:      
 
Domain Number 9 Region: 1212-1261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 10 Region: 1165-1214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000893
Family Laminin-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 607-656
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family Laminin-type module 0.0096
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|192596
Domain Number - Region: 660-695
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000112
Family Laminin-type module 0.016
Further Details:      
 
Domain Number - Region: 1007-1048
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000268
Family Laminin-type module 0.011
Further Details:      
 
Domain Number - Region: 975-1009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00809
Family Laminin-type module 0.057
Further Details:      
 
Domain Number - Region: 39-74
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0293
Family Laminin-type module 0.045
Further Details:      
 
Domain Number - Region: 1791-1896
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0575
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|192596
Sequence length 2864
Sequence
MDVVDADMDVVDADMDVVDADMDVVDAYMDVVDAYTTACKCDVGGSQSNRCDYAGKCTCK
PMIHGTKCDQTSDGNSVRFGFDSNEFHGYSWRGYAIFSRIQDEVLLDLDVRKAGLYRVVY
HYLNKNNQATTAEVRVTPDQRSHTDGHSQSSFVTFHPLVAPDFATMSSGGGVSSAFTLNP
GRWTFSLKTPESVLVDYMVLLPAAYYEAPILHEKFHQPCTVPSTSDICKHYVYLDLKPFS
NVPGSSGESGDGSYHEKTQLYDNQSNLDKLGLTDMAKLDERQTSITFTVPVEQPGPHVLI
ISYFTDDINRAQDMEADIQTPGARDSGVIRLANCPYSSPCRQFISDDSHNVKVINVDGRY
FTLTLNGRSDINLAIDKVYAIPLDKWHIDLIEPKFKCIYKKEKCIQGRPAGKPPGVTIEF
EIGSELPITPPPVIIEGSHPDPSIKVIKLHRREVMPRIDIKVQVTPGSYALVPLYYQPHI
VGFDVDVEVYAGGQFHKGTMRADPCPSLNGCHGIVKFKDRPNVDIVDSDARVSFNSTNPV
WLDYLAVIPSVSYSEKIHADNTEDDKSTEFINKCSDHGFSVDASGLQFCKDSIYSITTDY
NNGALKCQCDPDGSTSFNCDPYGGKCPCKSQFIIGRDCSQCKTGYWGFPNCRECQCPTGI
CEPRTGRCVCPKLVTGENCDTCLPNTFGYNALVGCEECGCDARGVVSADMECDENSGQCH
CKPNVAGRKCNKCKLGYYDFPRCRQCSCDLNGVLSDENVEGHDCSQCQPSTFSLLASNPK
GCSQCFCFGVTSRCQASDLRWAQITELQDWTVTNTMTTAEYDEGRRMWHLQEVHLQTTDQ
PAYWSAPMTFLNNKVRSYGGKLRYKLLADGMEGERFKSPDFILVGKSSRVSYVHGLQEVH
SSVEHAEEVHLVETKFVHERTGAPISRDQFLILLSNLQSILIMASPFKDTSYIKLSDVSM
DEAREDGWGEVADSVERCECPPNHGGSSCESCAQGFFRAKNGQCLACQCNNRATTCDQTT
GICINCRDNFDGPQCLKCKRGYFLDRQSNTCRICSCPLRLESNNFATHCDVSFAGVVDRC
YCLPGYTGKNCDKCAPGYWGHPMTPGGQCKKCECSGNIDERDPMACDVKTGRCLKCLQNT
GGERCERCADGYYGDALDGRNCKKCLCEPLGTDHCDHVTGQCVCKQNVYGPQCSQCVPGS
FGFHRNRGCEMCSCGVAATSSECDLISGQCQCREGVTGRMCDRCIDGYWNYLPQGCRPCN
CLSKGAVTCDKETGECQCLPGVTGPNCDKCLHKWIMIEGFGCKECDSCVQLLLDDIDVLH
RNVTQMKHDLTSVSVSVQTIHHLETLDRRYHDLEPKVKMLLTDRPSSGHDVIEASREIDE
VHSSAKTVLQTLNRLYNESERVEDSARDIKTEVNNYYESIRSKTKDLVDDALNKVRIKTD
QLTTSGASSNVDEMVKECTAILTEMRKKGFHDEKDMALNELAKANDTLLRARELLGRSHT
RLNRTTDINSSIYLILAQLQDLQRLAQSSAQRSAEVTKLLNELRNTKAHVDNKKRTSKNK
PGRLDKTTQKRQRWHDVGLIIKIKNNEGQIAKCLEESRKNLNVVDDDLNEAKKAFNSAIS
DLERLKTLVADAQRFVHKLVAENENLKTLLRQHTRMMVFDFRTDSIRTRSISNTESSVKL
AIEASGVYETIVKTIEEAWKDSQEAERLVNVARNMSVILSIDTSEKSAQLGNISKQINLI
KMSIDRAILPMFLADLVDKLAIIQGMLKSMKESEKDKSYTDVVKGLEDIKMEDYETIFED
SRSEVEENRQILSSYSTKLQELDKNLTASVERIRSLPQQLSEMNSDVRVAYQDMQVEVSK
IEETIFVMEDLTRQSDQLIKLEDELKYNMDLLRDYIRQARDAANLVTLGVNFTHESVLQV
RNSIDMPSSGMVSKISLHFQTKQADGLLFYIGKDSGLADDYMIGEIVGGHPQFRINLGSV
ETVVKGTKPVNNNQITTYEIRREGKDLKLFIDSNPIDGEVSGDSFTFQYDNSTKFYVGGV
PDHILKQNSNLSSILPRNKFVGVIENLVYDERMVGLWNFVDASGLRGAHFKKIKIFSEDN
IFTYGGTGYAHMKIENQLIEENLDVSFDFKTYSKDALLFHQGTDTQFITLDLVDGKLRGV
MDMGSGGLPRISESTYNDGLWHSVSFSRRNRVAVLRIDTYTVPRMAVNGWKMIYEGESDF
FIGGLKNPDNYTKPTKSRFKGCIRNFQAKSAPYPIQSAIEFVDVQYGCRQSIRVVSFPPS
PIATGYIKLFKDSFSLSNDFAMSFKFRSQQSDALIFYIFGDSQNIGLSLSLVDGYLKLVF
KDDDENASEELTSPFKFNDGAWHYVNVKRTKNLLSLETEDKWTGTRAFTSRARIPGQQHV
YLGGVPDSVSVTLKNVGSNKPFVGCIGDISINSKLQNFDEVQNADLINVDIGTCQYMDYL
PPQGPSSFYSTSTVDPGVINPELKGCTRPAYPLSTWKERGCEGSSASGYYYEYSDGPTSI
SKFVLTLNLKTSSPDGVIFYAYNQQHSDFIALFMKGGAMHGFVNCGGGITKTALQGVNFA
DDAWHNVYFRYEDGLVTLNVGRHSNNTALMGSQTSVEVTAPIFMAGLPQQVFQSSIVNFA
DKKPDTWMFNGELKDITLQGKPIESKLIARSSSPGAKCPVEQGIFFFPVSTPFKTYGSVY
PDYSAPTHMNISFMIKPRLLDGILFSVHNPANDEFIILQLVKGEFHLTVNNGQGHVMKSD
FKPSNKMFWCERKWYSVSANKVKNVVYVIVDGLRGTSGFGIEGYSSTDTSNELFIGGAKE
MHSGMLVSNSFVGCMKDLYVEGKPVPLRDLQFKGDILQDGCPVD
Download sequence
Identical sequences T1FU41
jgi|Helro1|192596 XP_009021395.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]