SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|192605 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|192605
Domain Number 1 Region: 348-389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|192605
Sequence length 641
Sequence
MLQMVREQHLHQRELHHLCNFQQCKHLRKLKIQQHHEQLLAQTTLVATPGPAFPQTPTAS
TSVSTTTPRTTPANTTPRSSVSVPVTSVVVPSIAPAAASTTALVTSVVSTLTPALPTALS
SATTTTSQPSTTFNIGITTMIPLATITTTTTSTTTTTTKAFVNTPTVTPINIISSTLFAA
TTMTPQPFTPPPTVPTIPIIPTLPPMPTMFTMGPTNFNTAAFTALPPANSIAQDVNSANV
NIVLMFCNMYTYPSTTNDQYVIQLRNQIANYIGNGFDQYRIAQITVSSNPDSGQMVAEFV
IRPGLPSNPNPPNDYIIQKLKEKSFNIVDLNGNKLATNCELSSVIPWTEYWSCPNRKCEN
GGSCRVNNAGRYSCICKSGYVGNYCDINLWPLLCLPIIFFLAALTTLFLCLYLRRRKRRL
GTAFKGFKSITTTSDTTKTSNTTDNTTDSKANPSPSTAANDKKKVDNESTVKVKPSPKPL
QTFYLPYNKPLTVGFSDVQFNDINADNSGSNPPQFMADRGAISKTGASLYGGGNAVASIY
GGRSILTQPIEDPDIYYQTMGQKMALAYNDYTFVPTGRISTAGSVVFHGQNRGSNGGNIY
NTVGNNVTATMSSRDHDDDVANDGTGYYHALGQKLAITFND
Download sequence
Identical sequences T1FU44
jgi|Helro1|192605 XP_009021413.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]