SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|192677 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|192677
Domain Number 1 Region: 153-300
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.23e-40
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00068
Further Details:      
 
Domain Number 2 Region: 621-643,871-1037
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-30
Family Laminin G-like module 0.0034
Further Details:      
 
Domain Number 3 Region: 290-423
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.25e-27
Family Laminin G-like module 0.0018
Further Details:      
 
Domain Number 4 Region: 1060-1240
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-17
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 5 Region: 443-586
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000758
Family Laminin G-like module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|192677
Sequence length 1388
Sequence
MTGKECDWEFEVGQEFQSRLIDTSGFAESVENPIFTRKDTKESFQWRIRNLPYPRNIYDI
SIENNFIIVKTTNKKYYKRFSIPDMVRLNLNIDRSNLSYDHFNNTLIITYKKPSKVLEHE
RNIINEIKKANKKYPDLQPQSAINITDPCQYPIPVGIEKYYIPDSNLWATSLTNKAREAR
FARLRGWKGGGAWTAGTSDSNQYLGIDLGYRQVIKFIETQGRRGSNEFVLEYYVWFSDDN
TTWRVYTNEYGTPMLFQGNTDDNTVVRNSLPYQLIARYIRINPQRWNRFISLRVELHGCR
FEGLLFYADGNQGDYLIVEMLRGKLYINYDLGSTAEETGDTTTRAGSLLDDNQWHDVEIV
RDKRYITVSVDRMKINNVTLGDFIQLDLDKQIHLGGIDNFLQPGKRLRTRENFTGCMENV
WFNYMNMIQDSRTNQKRFTSEIVTPVSLPYVDAYIEITDMSPDRRIRITFDFRSYNKDGL
LILTNPTPGNQRFIFKLNADGHFEYSIQTDKDPVVHNVIINRDPLAESSSFTDGLWHSVD
IDIIASQDRTPGRVSVTIDGKDDAGGETGFVGCLRKLYVQGQSMFTIDNNQANAKLIGKI
KCDPNPCEHGGLCSQSFETFQCDCGDTGYGGAVCHRSKHLISCEEAKWLYYLDGEIDITI
DIDDSGPLLPFKVHCNFKDSIKLDSDALQYDETVMALSHDSTGTMLVDGYQEPGAYVRKI
IYDAQKEEIDEIVRRAQRCEQYIKYTCFQSRLLSDAGIADLNRPSWGWFVGKEMTVERYW
GGSAPDSRKCACGLKNECKYMGSQSNNPCNCDAGMAHDDVFDDGYLSEKDRLPVKELHFG
DTGVIGDEKWGKHDLGPLRCSGDALYTNVVTFRKEDATLELPTYPGAVSGDIRFQIRTTA
SDGIILQNTGPYNFLEVKIVFGNIIQFRFEVGNGIQTLELQTSYPINDDNWHTVQIERNR
KQAMLRVDQQSPVYLDEPVDQEFRQFNLTSKLVVGAAVDYSQGYVGCVRGFQVNGVLQDL
MGIVQRGETTYGVSPGCVQKCSSNPCFNGGICVEYYSRYWCDCAYTSFRGWNCGREIGVT
LQPNNMIRWEFDQLSGDISTTEEEIIIGFSTQEKHGQLMYIRSQNKPYDYMSIEMNNNGG
IKVIIDVGWFRDEVNTILDPYVDLANSQQHVVRVKRTNQGTTLTITVDDYPPTRKDWTDV
PRNADTRLDNPRYIYFGRNETTPAGLGYRGCLFRGQWDNQFPLKRVFQDPRGPNVIVEPP
GSVREDMCGFEEYSLAPDVMEFRPTPSLRLSTTTPYWGDIGSGQMTIGDQALLGGCIGVF
LILLGGIFFLCTRYYYKRKREYRTYEAKDAEYFDNADYALVIGSNKQPEFLFSIPLDENF
KSSACKAS
Download sequence
Identical sequences T1FU66
XP_009021988.1.102002 jgi|Helro1|192677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]