SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|192857 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|192857
Domain Number 1 Region: 240-519
Classification Level Classification E-value
Superfamily SPOC domain-like 7.26e-74
Family Ku70 subunit middle domain 0.000000396
Further Details:      
 
Domain Number 2 Region: 26-237
Classification Level Classification E-value
Superfamily vWA-like 4.6e-56
Family Ku70 subunit N-terminal domain 0.000012
Further Details:      
 
Domain Number 3 Region: 548-594
Classification Level Classification E-value
Superfamily SAP domain 0.000000732
Family SAP domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|192857
Sequence length 596
Sequence
MDEFNFNLSDNEDEEDQAPSHRFHTNREAIIFLIDASKPMFEKKDDESPFETCLKCAKSV
MQNKIIQNDKDLIGIVLFATEKSTNEVDFKHIYMLQGLDQPGAEKILELEKLIDSLDTEE
SKYGHSNDYLLSDALWTCLNMFSQCKVKLQNKKILLFTNNDNPHSDDEQHKKQALSRVDD
LKQNNIELVLMHINKPQHQFDVRLFYKSILNDEESSELPDPSERFEELLTRVRIKSHTKR
MLQQVPFVISPDLSMAVGVYNLSQACHKPAPIKLYKKTNEEVKTVCKTFLKENGELLSTQ
DMKKCVEIANTKVCFEMDEIVTMKTFDNPGLYLIGFKKKSLIKPYFHIRPAQFIYPDEKT
APGSTTLFVALLKKCTDLSMVIICRYIPRKNTPPKFVALWPQEEEMDENKVQLTPPGFHI
IFLPYADDFRKVNFEEDALRATAAQVDKAKELVKKLQFQFNSDSFENPQLQQYYNNVEAM
ALARDCPEEISDFTQPDEEKIEKRAGKLIKEFKELVQMDKRSTTAANKKKNAPNAVGGGK
TSKHDDELDVEKEARNGKLNRLTVPILKECIKKLNIKSTGTKKAELIEAINEHFGI
Download sequence
Identical sequences T1FUD3
jgi|Helro1|192857 XP_009022335.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]