SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|192935 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|192935
Domain Number 1 Region: 65-106
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000288
Family Ovomucoid domain III-like 0.015
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|192935
Domain Number - Region: 224-279
Classification Level Classification E-value
Superfamily ARM repeat 0.000259
Family Exportin HEAT-like repeat 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|192935
Sequence length 285
Sequence
MPQRREVVMMVVVVLKNDVKCQQRSPSSSSSYSSSSPSPAYCDVTKARDYHTLCEAVRDE
VGKLCGRNCQTPCKTNAKVCGMDGVTYANECQCRCHHVPVDYYSPCYILPHFIDATSSKV
TCPKVTCSKNNLIKGCQSIIPPGACCPICASELRMLINKRLATTLRMNQENGITLSGLAD
NLESLLSVRECRIYVYISMDGDLVVLVTPSNQFASNNLVQACQQEASHIANMISTNHPTI
RYNAYLSLLSSAHHYHNDDDGDDEEEDEKDDDDDDDDENIRKCAM
Download sequence
Identical sequences T1FUF7
XP_009023420.1.102002 jgi|Helro1|192935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]