SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|192978 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|192978
Domain Number 1 Region: 199-266
Classification Level Classification E-value
Superfamily RING/U-box 8.25e-21
Family RING finger domain, C3HC4 0.005
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|192978
Domain Number - Region: 22-42
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 0.0654
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|192978
Sequence length 443
Sequence
MATSSNSNPSEPECEYDYGEDPHPGPYFCHRCQRCISRCTRDFTCPDCASGFIEPIALGG
ATTDVSGEENMDTEQAEQPTAQDGDGNNISISINHGSNSSPPQGRPMRRGVRRTRIAIHR
IPTNNQSDPTEAIQRFFREFMAGLLGEGLDLNSHFQLAMDPIILNGDESLWTRAGLDNIL
TMFMNEVETAGPPPATKDQIDALPDVVINQSQFDRNLQCNVCMEDFAIGDSAKELPCKHL
FHKSCIVTWLELHCTCPICRNRIGPSAQDRFRQQQQQQQQHQQQHIINLDALQGDATTPS
SSSQPSPPTSAAARSSSVSSTPQTSSSAPQPLSSLQQPPSLPQAAGFIPLPPHSVLFQVR
SAAVGGGHTSSSNDLATNNPNSSRDGSSSGRSSSSNIGGSGNSGGGAASRDGLVLGALRR
LQQQLQQQQPQPPQRYLDDMNLD
Download sequence
Identical sequences T1FUH2
jgi|Helro1|192978 XP_009023486.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]