SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|193005 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|193005
Domain Number - Region: 87-111
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0209
Family Spermadhesin, CUB domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|193005
Sequence length 288
Sequence
MAFLFLSERLYLITKAQQLHQHNNINLKNNNHNNNFKHNSFNNNSNAQQQQQQQNPSHVI
LTRENSVGYLGNVATEETGCGLESSPWVLMAPRGQRIFLQLIDFSVDSSEEKKHGEQTHC
QINVASFNTICANERKHSNVFASQSDTVLLLIHAAAYHPPSSRNNNNNNNNNNNNNNNNN
NGAVEKKSPPVYFLLKYALQGCADIVASPGQWVQRMGSVTWTGCNGTSEKFQFTCERDRW
ISEDRRAYDQGGSNIADLDCSSSWAELDATIVTIGLSAFCDHFSYACQ
Download sequence
Identical sequences T1FUI1
jgi|Helro1|193005 XP_009023572.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]