SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|193045 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|193045
Domain Number 1 Region: 310-548
Classification Level Classification E-value
Superfamily Kelch motif 4.05e-47
Family Kelch motif 0.00022
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|193045
Domain Number - Region: 25-82,126-156
Classification Level Classification E-value
Superfamily POZ domain 0.00628
Family BTB/POZ domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|193045
Sequence length 691
Sequence
MDNVHEIKKNGDDDDCTKIMLISNKGGCYEVDRKTFLQASSYFQALVNSGMRDAHSKKLT
FECLSDACLEEVSRFLSKLKDNDNRLEDLAKDIRPLMHIESGLEVSFYLQITFMIDMYRN
YVLKNLNKSTFIRILELADMYCWPEVTDNAFNFIFDNLQNIMKKSEMLKLTSDDMLRLVK
SDLVNVPSEYELFKLVVEWILVDVPRRKWTEELLNKINFNLMTIIEKQEGYNILSELQLN
VQPRGCDSNHSRTVGTLFAFGEPTTIKRKRKNQLFHTLSVYDFFKASNDKNKTTTAAKFK
NGGVVAPLHYYKHYKSCVADNRLYIAGGYLTNSFRIYKKRTFVYDPVSREWSQVSDMHVG
RVKFYFGAVDGILYAVAGFSSNPTRSVEKFVPCENRWYELAPLPTAAHNLAGTVCNSKIY
VCGGRNNVSWSLDLLWQYDPIRNKWYKKSPMLTARFDHVMTSIGNKVFVVGGIICHADDV
ESIRYEEAMDMEAYDCLTDQWTSVLQLKRCIINFPSITINNSLYTFDDYSYRHCKKINYI
DVQKLNLSKYLDDDDANKNLNGIVGDWSSTDKENISPRDDVDNVGEDGYNIEDDIETIDE
NLRDYFDSIDYMDSEGRFIDLHNTNPVGDDKDDHGTDENEDSNSEDGEEFDFNEINQESK
DYQIYRYKTKNSHGFHCVGILNFPTNVQDNN
Download sequence
Identical sequences T1FUK1
jgi|Helro1|193045 XP_009023649.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]