SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|193057 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|193057
Domain Number 1 Region: 20-60
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000055
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|193057
Domain Number - Region: 19-126
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000534
Family Growth factor receptor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|193057
Sequence length 145
Sequence
MNLPLVLLLSFLSGAPLVVSDCRNHNCQNGGTCVPQDQGFKWDYHCECPAGYKGEQCQWD
DTSVCVDNTITPCKNGGICKNGINSGERYCDCPGKNATWFKYGGHYCELIDPCTTCPYGT
KICQSIPTQKSGRFCLDNSKREYFA
Download sequence
Identical sequences T1FUL0
XP_009023685.1.102002 jgi|Helro1|193057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]