SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|193062 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|193062
Domain Number - Region: 160-260
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00628
Family Spermadhesin, CUB domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|193062
Sequence length 663
Sequence
MTTILAAILFPGICRGLILHESFPVFNTETYDAKQSDQHNLEANLVSVRANLINIIYERE
EELKRELSITCQTNYVLNILTATFYLTNSTTTLATACANIINSGDNDHQNTDIESSSSGS
SSTSVERSACFDCQNDDHARIVPPRGYLASVVSQQERANHQCGTLKCPWTFSFPPGKVVN
LTVIEAGSSGLQLKSSGESSSSSSCSQSLLSVKELRKNYPYCSGENRVNHLHLSLINSLE
VSFSEDRLSDVNPQFLVYYEVLGCADLTPPMYSRMRRRGEVTTIDCPGTDIRWEVKCING
SWLDEKLIGTCPKFPGLVDPEIAPQKSESIFNTSIFNMPTGVLMALVISTAVILGVLIMT
TGLVCLKRHQFEVKHKDDPNVYGAACSEFEFREMGAAGASLLHGKSPLMNGPKPRRPSAD
LLARDNTYAMQDMKMDARPLPSLPNATSSQDSWRRNDGGQGPVPYGVFPSNQVQNRVTVQ
FHRADNGADVMASGYPIPGGTYRGRYPPNQYPSTMHSGQMPQRYMGPGGTNTGRFDARSM
APQRRPSGYGNAARMPNSSNYDANQDDGSHLYFVLDGNAKDERNDLTMGGGMPTSTLPQP
PPAHQQFPMAAGVNPRLPPPPAGGQIGMMTHRHQQSTGGGVDPRCTCDDHGAFKSSGSLN
NQL
Download sequence
Identical sequences T1FUL1
jgi|Helro1|193062 XP_009023732.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]