SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|193182 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|193182
Domain Number - Region: 57-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00544
Family Merozoite surface protein 1 (MSP-1) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|193182
Sequence length 211
Sequence
MWQKVEIQGSISPDLDAQGKPTKYNYCINDMIESTMNHCRSGVCVSGWTGTLCDKRDCDK
NNGGCNSRMDCTREIVNNVMREKCICKDNLVSYMGTECLDIARISDNARLRDNLIYSAIA
ICGIATIIFILVSVKCSKKELSVYWISKKHTDFWPINTTTSNTDMFKRLLEYQQQYACTI
AINSPVAQLNNSQLQPNYLQSIAPEKYQFKA
Download sequence
Identical sequences T1FUQ0
XP_009024162.1.102002 jgi|Helro1|193182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]