SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|193192 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|193192
Domain Number 1 Region: 168-359
Classification Level Classification E-value
Superfamily vWA-like 5.98e-49
Family Integrin A (or I) domain 0.00032
Further Details:      
 
Domain Number 2 Region: 522-562
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000602
Family Antifungal peptide scarabaecin 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|193192
Sequence length 563
Sequence
MKIFLVPCLIVSTILSVQGAVDETLVERARGFAVVQSVCAKINLACIFPEDKLILRRIAY
VESNDGLDGDAYQPGYYGGIWKVDESNFLATKSLNPSLQSSIYAEFNIDWKTVSWKDLLK
PFYSGLAARIYLSMVSPNIPRSAEDQALLWNQNYRKNGQTSVFVDKVNKLNTGCKQGVAD
IALIVDGSGSIGINNFNVVKSFLKNLTESLNIGPDPELHTRISVVQFSNSVQQEFDLNDH
STLAGYGTAVDKMGYLNSGTATNIALDFLATESFLQSSGARGAGIPKIGIVMTDGHSNNL
RDTLEAAKRLHQKDITVIAIGIGENINNEELKAIATDPDCKNVFRLDGFFDLEALKESIE
ITTCEAPIYVSNEEPMNFTLPPFESKNIKITVSPSGLTIEIGGGDGVVFFSNETYPTSSF
YDMKINMFFDIPAVAYFPGSTKLIDRYVYSRIESNTDKPCSYEIETVNKEINRCDPNPCP
SHQKCVPKKHFSYGCIDEPRTSTTYNCEDKNPCTNENADLGKFFFPHDDRTKYVQCGQWE
TCHEMTCRPGMVWSSRANTCVMS
Download sequence
Identical sequences T1FUQ4
jgi|Helro1|193192 XP_009024215.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]