SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|193289 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|193289
Domain Number 1 Region: 202-328
Classification Level Classification E-value
Superfamily TNF-like 1.03e-29
Family TNF-like 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|193289
Sequence length 330
Sequence
MSPPTTTATTSILITLITLTTIIVLNDCTNSDLQQQSQTQQQQQHNQYQQYNNNNNNLHS
LQHQKLQHHHQQQQQQQQQSKSKQRHHKNNNKNRPLRARDVSTTSTTSNNNNNNNLATYG
QDGFCELELVCKSNNNLINNLHTHSNNNPNSNPTSSGEAHTAHIPVKLPIRGPKGPPGPP
GERGADGMPGFPGSPAPAFKKKVAFFAGLTQNFGPTVDNTDIIFDRVITNIGSGYSPSTG
RFTAPYNGAYQFNVIVSAQGREKAAVMVLKNGEMVATVWAESIPYWATSSNIVVLSLDKG
DQVWLILLNKASHLHGYMYTTFSGFIIFDL
Download sequence
Identical sequences T1FUU2
jgi|Helro1|193289 XP_009024669.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]