SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|193396 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|193396
Domain Number 1 Region: 542-659
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000209
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0088
Further Details:      
 
Domain Number 2 Region: 168-402
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000215
Family Galacturonase 0.073
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|193396
Domain Number - Region: 949-1105
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000141
Family Pectate lyase-like 0.031
Further Details:      
 
Domain Number - Region: 805-906
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.046
Family Spermadhesin, CUB domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|193396
Sequence length 1144
Sequence
MVDLVDYNPDTSEEQVWVYDGRASSINDYTKKWVVDDDIIDFPVVSQMFFMTVRWSLTGV
ASGRLAFVVRSKQGNWNYPLGSISLFNNILDGNRYGMVSNVFNQPSDEYLSIFHRYNWEK
VDVRNCTFSNNKFGSIAVYSMTKYNSLYFPASSVLETSLKIAEVSYRIHSCIFTNNGGGI
VASHVGLGFSNNVWIWEVSDLTFTKNQAGGLFIEFPRVNLMFTDLFNHSININGSLFSHN
DDFEFVIGGFYCNASISSNKFHHNKCKRGCIEFSGTEKDFEFRDNQVSDNMGRYMLEVNM
NSHTPYTQWVEATVVYNSFENNEGPRMLFDRNLVSEISYAVGVRGLQNITINRNLVNNPY
MSYELLGGQAASKFENYLDVTENWWGSIDQVVIQKRLFDFDDWNNFAVAEYIPFLMNPTF
EAKPSTENKLRNVIDLSKPLGGRISESIKIPFRSQPYVVERDLTVMEGYSMVIDEGVTMQ
FYPGVGILVLGSLFAYGSSNNKITFQPVDKSKIKKTPSKRSLEDGKPRLYIHPDLHPYVG
YEMRLRGGESENGGFLEIYNNTEQRWTIVCDDAFNEKTAEVACKTMKKEHSNVVVQRSRF
YDIFVLGYQLMAEQVIEWFWRETMICDGSESNLNDCKHRLNYDLQRCMLQGNYVYMRCGD
RNLAENFDYWGNIRFSSTSFESDYSNGIDSKFYHANIYGAGVLHEEKVAAVQSIYKAPDS
KHVSIQNSAWNGYDFIAPDDQFSILDGAITNNNGYAVGTIILNGQSSEDDSQFVTLQNSE
MPQNLHGIVRMCTVEKFILIQKRTLVYYRYSFDNVDCIKIFRSKEPHKQIGFRFLQFNLF
NDSIYTNAVELYDGEFFAPDHMISKLTYNSTIQQQKKFFTTSARFDTLGVRITASTAYGG
YGFVAEVVTLPISSRFKPDFGLNQQQTISRNNMADNLRGGILYRNVGENNPRIVIEKNHV
VNCGLKVLNNTFPGVIDIFLQNTRLLTVSNNFISNCAGGITINTTTKSSESSIYANVTNN
LIMRSTHGEPMHLEGHHFQKFQVTHNYVSNNDVQFRNIISAFGLQLNFTSNVLVKNVAQC
ILNASLQEKIDISQRYSYNSIYNNHAFAYNRSTICLKSAKFQFTHNFLLNPYNVFEMVTF
NRTK
Download sequence
Identical sequences T1FUY2
jgi|Helro1|193396 XP_009025053.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]