SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|193539 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|193539
Domain Number 1 Region: 76-132
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000778
Family B-box zinc-binding domain 0.0044
Further Details:      
 
Domain Number 2 Region: 4-57
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000412
Family RING finger domain, C3HC4 0.0094
Further Details:      
 
Domain Number 3 Region: 342-476,565-639
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.000000000889
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|193539
Sequence length 641
Sequence
MENLIKCRLCMDVLKGPKQLPCFHSFCSLCLSDYESKFTVDEGFYCPICGEKFLPDNKAA
CNETKFLSRMVKTDTRAEKSFCSVHPNVEINFFCVDCESMGCPVCSTGYHDKHNCIDLQE
MAAVVKEEMRSMSRDIHRKTTQLENEIEAELKTKKEVLDELDLTSKEIKEKAEYLEAVIK
RQAADLLKQVSQVKSKCMKDMENFKMNNKKSIDDDLEYFNSYVKAMLEHATEEELIDSVR
NVKRRTEHIKMFSLHGKERETTSAQFIPSNLHIDTLSLLGHIELQKKIKEFKKPNSNLET
LNTASTIEKVPGCEDVDGRNVEESLRNVPKVVWKKCKETSCGVAAIAVGRGEFFVAVENS
GDILRFDLTTLKEKPASERIHLPDLDTPWDMTTIISDELSHTYVFILDNLHGKIHQINVP
FNPSIGPPKFIMKSWLVPLNETLSLSSNQDRLLIAGVTNKILEYSLSSLLIISSSSSSSL
TGLTFPEPTTSFSVIPPIRDILHASRLDDSHFVTLFDHLYELCGVFLVNEWGKMVKSFGE
GRGSVAHLQVDYPVHAALDRKEPTDSDHHSHPSTSRPYNDSCFIFVCDANNGRISLFDGD
LTFLTILDDNIMDAWRLAIDPLNKLLFVATLNNAFYVIKYQ
Download sequence
Identical sequences T1FV38
jgi|Helro1|193539 XP_009026425.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]