SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|193581 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|193581
Domain Number 1 Region: 565-611
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000809
Family Laminin-type module 0.00065
Further Details:      
 
Domain Number 2 Region: 672-722
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000837
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 3 Region: 463-514
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000167
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 4 Region: 720-758
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Laminin-type module 0.0081
Further Details:      
 
Domain Number 5 Region: 620-669
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Laminin-type module 0.0041
Further Details:      
 
Domain Number 6 Region: 12-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000809
Family Laminin-type module 0.049
Further Details:      
 
Domain Number 7 Region: 63-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000893
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 8 Region: 1100-1282
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000144
Family Tropomyosin 0.0017
Further Details:      
 
Domain Number 9 Region: 522-567
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000642
Family Laminin-type module 0.0036
Further Details:      
 
Domain Number 10 Region: 118-167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000879
Family Laminin-type module 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|193581
Domain Number - Region: 821-1065
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000968
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.016
Further Details:      
 
Domain Number - Region: 422-465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00363
Family EGF-type module 0.058
Further Details:      
 
Domain Number - Region: 172-233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.017
Family Laminin-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|193581
Sequence length 1372
Sequence
MAVAKELNNGRCKCNGHASKCVDNACICEHNTTGESCEACQPFFVDRPWKRATRNDAFEC
RACNCNGHSEQCIFDNELYQRTGSGGRCLNCKNHSSGPHCEQCNVGFYKAANNVCRPCAC
NSTGSRSEHCSERGVCQCKYGVTGDKCDKCLPNYFLFGPDGCKTCECLAAGCQNNQPVCL
KGSGVCQCKENVEGDNCDVLEGWRVEWGLWLCCKPGFFGMNLDNPLGCLPCYCYGHSSRC
TLSLGYFMQYIHSDFQNGAQGWRGMSGSDVEVPLQFDQHRRAVRLSSSRHDAQVYFVAPD
RYIGNQKNSYDLYLTFELQTNNDRSLTSPTDIIIEGVNGHKMYTSLTSQNNLVPRTANQN
YKFRLNEYPTYEWSPKMSTREFVDILSDIKSIKIRGTYSPNGEGFLSSFKLESSAASYGH
RPATNVERCECPVGYVGQFCESCAPGYRKEFGGSSPKERCIECRCNGHSDSCDSASGRCI
CQHNTVGNQCEMCAPGFYGNALRGTPHDCKLCPCLDNGECMEKGGEVVCTKCQTGYAGKT
CGECDDGYYGDPTGVRGRKSPCMPCQCNENVDPNSIGNCDRWTGECLKCIYNTAGPHCEH
CLPNYHGDALAYPKGQCKSCHCHLPGTASQHGDPCDLYSGQCACLPNVIGLKCDRCVDGF
WNINSGRGCERCRCDYTGSFNSSCDHHSGQCHCKPGVTGRNCDKCDINYYKFSQTGCTPC
HCNREGSQHEQCDPVTGRCICRPNIEGRACDRCSENRYLDERGSLLYINKKKVHENLFPE
CSECYTLIQRSANEIRVKVNDLRILIQKILSGAEIGDDAEIRNRIYFLNQSISTLWLQAK
NIKGGTGGNENEIYELTRRIESIQQIINEIVYRMGLARNNNERARDEIATANNILDIIKN
SFSDLDYKINEGKRLLILLYEKMRNYGYGSDQLTRMAKEARNFADRHSEESHQIQLIIEQ
ALQTSEEALATANSILPGQDGAEHNIYFIKKRIAKLNEEMTKTSSVTTSCWEDSLRLLNE
ITILVRDIQSIQVDGSNVQHLKQEVDRIRQKTEHKKLEWESLKRENHEFVRNIESVLHEA
FMLVNMLISEKQFIDETLGDADALHDRALRASESSHELYEKIKRTLEILLRYDEEMRIKE
ARAQEALKKKPKIESTIYGAEKNIYEAQMKISNAEINADTANNDADTIIRIIEESFKRLD
EIEREAMKSNETSEHIRETTVKSTSNIEALKKQIDEMHKKTIEWEGELKQESDATDLTFF
DVDQLTQRVKDMDSKLDTFINQYASLEDLDLVMINKAYELVSRLDEKFTSFDWYNRFNHI
RNIDSRLEVWLTHYELILQQLKLDMDNARHISLAIPSMCFKITELEISEWNR
Download sequence
Identical sequences T1FV52
XP_009026569.1.102002 jgi|Helro1|193581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]