SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|193911 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|193911
Domain Number 1 Region: 511-667
Classification Level Classification E-value
Superfamily vWA-like 0.00000203
Family Integrin A (or I) domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|193911
Sequence length 958
Sequence
MEKLTKTIPTANIIINNNNINKYNISNNNYNASNDNNNKINDNPPKTSDERITRQISSKE
WIKLFGLEKNKLDMKNILKRVGFKHCSDFNEALKMPVCSRYGTRMFRRYFNRDGQTYNLV
LSPQQLTQFEYQILELIDLLENRLRWLMSDSRRTFGIILEKRVCIVIDVHAYDADVMRSQ
FDVIVATLKEQVSLTNEFNVLRVSHTVEMFSEGFIVTSSESVERCVEWLRARQPIDETHI
TDIVNAFSLASKLKHMSSMSTAVHIVVSMCDEADTLAFLKNICNHFDTRFHAYSIVLQLQ
TYKLKNDTNNNNNDGNDGKMRLVACTKKHGGFPEGAGMSQEVLEIFDEIEEAKYNLDQVK
AILNEQVGQLNKGFKREPEKEKSTKFSKDFSLSSADWLRKHGLKSRKLLFYDALTEVAFR
HADEKNEEDDFDGGDACRAAVVKRRPVSAKYCGNFVHMKWHDDDVVHIHLTEDFHRNYLT
KMQTALLDLNSRLEWLQTGSRKVFGVVTENRIYILVDVSKRMSFQGNFLKENFKLLLQEQ
IKQKQKFNIIGISSAPQLWKKSMVKVSEANIESAIFWFKNLKCTGSCNLADSLRYVLKCS
QCTGIYLLLSGLADQPPAFLLDEIRSQKQCPPINTMAFCCSEGKVLEFLKSLSNESNGRF
HTFSTDDFNGDACCDVCESDDIHLVRDEIELAEMTLIKVTSLKNECSNVPNNNHAQRQLA
NNIKPRSKSATIVRRKYSIDESKLVLIDPDLLSTKEWLSHFGLLAQGLTLNNFLKNVILN
DGNDKRSGEGAKKYPDVEGSKRYQQIDSSRNHPNFDKILKLLLKILPKKMATNLENNINV
EELKNLDFETFETGLTQCKSQIEKRLDTMIWNVLSNKQRRRFQFKLCSFRQHKRELLNIL
EGDGWPVRRDEVNLLNDEATRCLILIERIDKLKKKKKKKKKKKKKKKKKKKKKKKKKQ
Download sequence
Identical sequences T1FVG9
XP_009028084.1.102002 jgi|Helro1|193911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]