SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|193978 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|193978
Domain Number 1 Region: 172-206
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 70-103
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0034
Further Details:      
 
Domain Number 3 Region: 129-164
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000419
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 4 Region: 5-42
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000275
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|193978
Domain Number - Region: 252-285
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000122
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|193978
Sequence length 318
Sequence
MRDDCLHSEFRCKHSGVCLKNVPRITCDGLIDCPPGEDETDCDAVNFDMYGGDEDYDRGY
SGVERSCLLWGGHWCAVSQTCIPASKKCDGVFHCSDYSDELECSPSAHLSSVEDYGDDDY
DELFPAEYAGSMYTKCREGHKIILKLEVCDGEKDCSDGSDEEDCDEKKKKKLCGPDEFSC
PDMCIPETFVCDDYHDCFDGSDEKNCSLKKEICKTPFKICNGTCQLVHELCEDALDATCA
TESHPLCNVCHWGRCSQLCRNVDLKPVCSCRDGYELERDNFTCTSKYFYTGKPYLLFAGR
HDIKKIDIYLPAPSKTAA
Download sequence
Identical sequences T1FVJ1
XP_009028234.1.102002 jgi|Helro1|193978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]