SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|194111 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|194111
Domain Number 1 Region: 158-282
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000101
Family Spermadhesin, CUB domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|194111
Sequence length 677
Sequence
MVIIDRLELIDRVLTCSFCFVFLLGPFITADANKNNADLYGADLTEFCQSEKFQVGCSNP
DEVIYVTYAASGIIQGKCYSNNFGQIGCFDNVTDYMNYKCAGQKSCSFKISDDEYLDELF
KKCMKEFKRALFIKHECIKVDKSACTTCSEHRTARLSYKSGFLSSLIADETKNGIQCGSY
KCPWSFVVSPGQRINISIHDYTGFILKKNSLNKYNERGDCLRLMTIREKSNPKDVEVCGG
GGVIGHRQVYLSTSNSVEMYINVDGHARGQQFIVHYEASGCPDIIPTQNMWMNRKVDKLE
VGCLPSDSSSWEMVCVNNEWKGTMGSCDPSDPLMGSVFSKIGTSMSSFFSSLPFGILLAG
VLAIIIILSVCILTVGYVCYKKSHHQMGYKRRPQSISGDQYIDLNDPNNLLVQKVIVGKT
MTCKGGKGYNYANTTVVDCGPNENKYAGRAMMMANQMIQSGGGVRPLPSIPDLRGTGANT
NHRGGGVAGGAAQPPRMMIRSYGDGVGMGVRPPGAYPHVQGGIRPDQQQQHEYYVIEDRN
RMNNMNMMNNNTGSSAGNDSDSFPPPPDLLFPADSTQGSLMRPHQQQQQPQFSQQQLVSS
LAQQQQQINAAAPTYKPPMTLSSALKQQNNTYENQQVILGTMATAGITAVAAASTAMAGK
AAISDSTGPSISAPLDI
Download sequence
Identical sequences T1FVP6
XP_009028565.1.102002 jgi|Helro1|194111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]