SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|194137 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|194137
Domain Number 1 Region: 506-549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000225
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|194137
Sequence length 907
Sequence
MLLFLYFMLLPSISYGFTEETTFYKNMPVYSYRNFGSVQTFSIDIPPDTFKAVWNVSVNR
SQTKCYERMVFIYAQYGSFPVEKFDGNETFTDKFLVNRTGLLKDNVTHRKTIEFHRPVYG
QWFLGGVMERSNNEVIKKLDLSVCDHGLESNITFYIGDVSILLANSATTIRLYDNITTYY
KFLTTRTTYKYRVTISNCKQEQCNFRILFKSKAIPNTDDNSSEANNNSHYITIYGAAGNN
NNSQNDINILANNDSNNIKNDSYLEVFSPSINSWQYIAFVYDGIGAVFDNSSIEFDALVS
LYGNSVYQTIFNEADSLFIPRPSLVTMTTFDVDVMRDVGGTLVMEFTLIPLSLDFQKSPK
EFQAAVCIQRDYPTVTTDNRLHCRDPGSLIILNDNNSHHLIYVPYPESGIYYIGFQEWTN
ESFEDVKHRGSVIEEERKMRSGSGGVGPGGEGSATTTTTNPLERMLKDREVSVNELLRKV
LVTDGLRNVSHYELKDPSMGVLVSAHISSCLNKQCENNGVCRFVEKGPYYLSFCVCSAGF
NGFFCENNSPTSERVELGLQGFLCQDKSNMVSYSLQMWYTVMLTCSNLAFIPAMIIAFKR
WRFIEFCVYTLNMVFSTFYHACDMSAWSVYGFCVVRYSVHKYSDFLLSLLSFWVTLLAMT
RIKSGKVAVVVALGVVVVVVVCGVVWCGVASCRRHLLTLLTVGIVMIAIFVNSSNEVWTN
VVPIATGSIVVIIAWVWKGVKSRSLFPDKLEYRWMVPGILLALLGIVVFAFLENDTNYPY
THSFWHIAVASCVPFLLPRKKSFWELVDLEETIKISSSPVASTADGNTFTFASGGESSHN
NDDDEVVLFAQGSSFFRNRQAGRHAKSVANHHHQLHYNTNDTSKVSLSPLSSAAESLSST
DNLIRIK
Download sequence
Identical sequences T1FVQ8
XP_009028609.1.102002 jgi|Helro1|194137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]